Gena Suarez
The Old Schoolhouse Magazine

TOS Items of Interest






Schoolhouse Planner Calendar













TOS Current Issue

The Fall 2009 issue will be
coming soon!
Click here to Subscribe!



To see the current cover up close, click here





Meet the HWTB Writers

Team Leader

Tia Linschied

Monday

Karen "Spunky" Braun

Tuesday

David and Kim d'Escoto

Wednesday

Susan Spann

Friday



Cool TOS Links

  • The Old Schoolhouse Magazine
  • HomeschoolBlogger Company Porch
  • TOS Magazine Writer Guidelines
  • How Do You Homeschool?
  • Back Issues of TOS Mag

    Just Stuff

  • Home
  • View my profile
  • Archives
  • Friends
  • Email Me
  • My Blog's RSS
  • Curriculum Reviews!

    Homeschool Gold

    Intellectual Ammunition







    TOS Products!


    Do you have the whole set of back issues from The Old Schoolhouse Magazine?

    Click here to view all back issues and read the themes - you will want to collect the ones you've missed!!

    Schoolhouse Store
    Always FREE Shipping




    Recent Posts

  • A, B, C, D, & F Too Hard for Parents?
  • NEA Puts Power Ahead of Kids
  • Homeschoolers and Health Care
  • State Mandated Parental Interference
  • Artifically Induced Dyslexia?
  • Courtship in the 24/7 Era
  • Reaching Homeschoolers
  • Holiday Idea Book--No Charge
  • A Truly Divine Appointment
  • Who is a "true" homeschooler?
  • David and Kim on Issues in Education
  • The Pros and Cons of Co-ops
  • Watch Out, You May Get Forked!
  • Beginning in Jerusalem Part 4 (final)
  • Obama Schooling
  • Planned Parenthood Clinics in Public Schools?
  • Dumbed Down Teachers
  • Begin in Jerusalem (Part 3)
  • $7.95 Subscription Offer Still Good Until Tomorrow at Midnight!
  • Confidentiality for Who?




    Homeschooling Methods
    At Bookstores NOW!!


    Gena's Website Pick of the Month

    Homeschool CPA

    offers the following e-books:
    Money Management for Homeschool Organizations. A 39 page ebook covering money management for small, medium and large sized groups. Sample forms and examples of financial statements in clear English are provided. Also covered are topics such as using Quickbooks, collecting fees, creating a budget, insurance, and hiring paid teachers. All written specifically for homeschool groups.

    501c3 Tax Exempt Status for Homeschool Groups. A 51 page ebook explaining the pros and cons of tax exempt 501c3 status. Is it needed? Is it worth it? Also covered are non profit incorporation, the application process, and how to maintain tax exempt status. All written specifically for homeschool groups.


    Ministries I Like

  • Grace to You
  • Creation Ministries International
  • No Greater Joy


    Award

    My BlogRoll

    - ... and his ministers a flame of fire
    - 21st Century Reformation
    - Aspiring PolyMathis
    - Back of the Envelope
    - Be Bold, Be Gentle
    - Bear Witness
    - Beyond The Rim...
    - Blog for Books
    - Blogcorner preacher
    - Blogotional
    - Brandywine Books
    - Broken Masterpieces
    - Burkean Canuck
    - Cerulean Sanctum
    - Christian quoter
    - Classical Education 4 Me
    - Classical Education in Paradise
    - Comment Me No Comments
    - Confessions of a Homeschool Dad
    - Daddypundit
    - Damascus Road
    - DANDELION SEEDS - Scattering inspiration
    - Danny Carlton
    - Day By Day
    - Defiant Lamb
    - Good Will Hinto
    - David Price
    - Exiled Preacher
    - Grizzly Mama
    - Hard Starboard
    - Hatless in Hattiesburg
    - Holy Fool
    - Home Where They Belong
    - Homeschool Mom Blog
    - Isn't It Rich
    - Jack Of Clubs
    - Janne's Jabberwocky
    - jeffmcfadden.com
    - JivinJehoshaphat
    - Journal of a Domestic Athlete
    - Journeying...By Grace Alone
    - Julie's Life in Living Color
    - Junto Boyz
    - Kramjam Reiterates
    - Ladies in Training
    - Lessons Learned On the Farm
    - Light Along the Journey
    - Linda's Thoughts
    - Logicus bLogicus
    - Magic Statistics
    - manasclerk's The Power Struggle
    - me autem minui
    - MediaCulpa Blog
    - Midnight Hour | Do you not know there co
    - Mike Perrigoue
    - Monopedilos - having but one shoe
    - Neumatikos
    - Northern 'burbs blog
    - Off the top
    - Ogre's Politics & Views
    - Old Path, New Song
    - Our Little Homeschool Farm
    - Patricia Ann's Pollywog Creek
    - Paultastic Musings
    - Pete The Elder
    - Power of Change...
    - Principled Discovery
    - PRMAMA: Marketing to Go!
    - prosthesis - technology and science
    - Pruitt Communications
    - PR Ideas
    - Pseudo-Polymath
    - Quiet Life
    - Random Yak
    - RazorsKiss.net
    - Redirect
    - Reed's Blogged Arteries
    - Reformed Politics
    - Revenge of Mr Dumpling
    - RightFaith
    - Rooftop Blog
    - RootleWeb
    - Scotland Diaries
    - secundum Christum
    - Shades of Pink
    - South of the Gnat Line
    - Sprittibee
    - sprucegoose
    - Spunky Homeschool
    - Spurgeon Collection: Sermons and Writing
    - Stones Cry Out
    - such small hands
    - Sudan Watch
    - Sunny Side Up Academy
    - Susan Wise Bauer's blog
    - Tami's Blog
    - Texas Raisins
    - The (In)Scrutable Observer
    - THE CALVINIST POLICE GAZETTE
    - The Common Room
    - the evangelical outpost
    - The Greatest Pursuits
    - The Grey Shadow
    - The Official HSB Community Blog
    - The Prattling Pastor's Wife
    - The Protestant Pub
    - The Rogue Angel
    - The Young Evangelical
    - Then Jesus told his disciples
    - This Little Light Of Mine
    - Through a Glass Darkly
    - Through It All
    - Through the eyes of HappyApple
    - Tim Thompson . . . Reflections
    - To Tell You The Truth
    - Trying is Bravery
    - Under The Sun
    - US Navy Retired
    - Vibrant Woman Writer
    - View From The Pew
    - Walking Circumspectly
    - Wesley Blog
    - Wired Wisdom
    - Wittingshire
    - wooQ: Theological Christian thoughts and
    - Writing's of an exceptional being
    - Raising Three Knights and a Princess


    Entry 653 of 1473
    Last Page | Next Page





    Subscribe in NewsGator Online





  • Home Where They Belong...


    subscribe






    "Stay, stay at home, my heart, and rest;
    Home-keeping hearts are happiest,
    For those that wander they know not where
    are full of trouble and full of care;
    To stay at home is best."
    ~*~ Longfellow ~*~



    Jun. 12, 2007
    A Little News - And A Little Gift for Helping

    This year's Father's Day is all the more special to TOS Publisher, Paul Suarez. You see, he's expecting a new little Suarez. And it's this week that we're finally "unwrapping" the news to our friends - You. Gena is due December 15th and all six Suarez members are falling over with excitement and thankfulness to the LORD, kind Giver of all gifts. This makes number five and he or she is a "far fifth" - you see, Julia, the youngest Suarez, will be 11 years old when Baby Suarez is born (and is she ever ready!). Eldest Suarez child, Paulie, will be just shy of turning 18. Doesn't matter. The whole family is beside themselves with joy! Especially Dad. This new, precious "little guy" as we call him/her already, is an answer to much prayer.

    Now here's where your gift comes in. TOS Magazine's Summer issue is getting ready to go to press and we have an important goal. We want to end our "19 Gifts" campaign this season as soon as possible. We only have about 1,700-1,800 "19 Gifts Packages" left and we really want them gone. Our thought was that if folks knew exactly what they were getting along with their two-year subscription (about $275 worth of educational goodies), they'd jump on board fast. Once the gifts are gone, they're totally gone. New subscribers AND renewing subscribers are welcome to buy the package. Subscription not over yet? No matter - we'll tack on your remaining issues to your new two-year sub. The total amount is $39 and you get all 19 gifts plus a two-year subscription to The Old Schoolhouse - a homeschool convention in a journal. Each issue is approx 200 pages!

    It's really true! The next 1,700 - 1,800 new or renewing paid subscribers will receive 19 free gifts (most are downloadable items) from popular homeschool companies with a two-year subscription to The Old Schoolhouse Magazine! And yes, we're serious – even the shipping is paid for, making these gifts an approximate $275 value. Your NINETEEN free gifts include valuable resources from:

    • Answers in Genesis – "Evolution Exposed" (paperback)!

    • Art of Eloquence – Lesson from eBook "Say What You Mean: Defending the Faith"

    • Family Renewal Ministries – 2 Heritage Copywork eBooks - Humility & Honor

    • Grapevine Studies – Day of Atonement lesson from Biblical Feasts and Holy Day Book!

    • Writeshop – One Copying & Dictation Excercises eBook plus a WriteShop I sample lesson!

    • Knowledge Box Central – Astronomy & Astronomy Games Lapbook

    • Knowledge Quest – Globalmania eBook - Master World Geography in just 7 months!

    • Help Me 2 Teach – Month of Service to over 1500 Websites and Thousands of Resources!

    • ACT Advantage – 12 Month Subscription to Learning Resource Video Rental Library!

    • In the Hands of a Child – 6 Month online Membership to Hands of a Child!

    • Miiko Gibson – "Being a Good Friend" eBook for girls and their moms!

    • Hope Chest Legacy – "101 Ways to Bless a Homeschool Mother" eBook!

    • Home School in the Woods – History Sampler and Mini Resource Pack on Authors!

    • New Harvest Homestead – Four issues of New Harvest e-newsletter!

    • Paws & Tales – 30 Minute Story on CD & Teaching tools from Chuck Swindoll!

    • PEAH'S Homeschool Digital IDs – 1 Digital Homeschool Student ID Card!

    • Pixlit – 1 Month Unlimited Tutoring for the Entire Family!

    • Walden Media – Calendar and Growth Chart for ages 3-6!

    • Jim Hodges Audio Books – "With Lee in Virginia: A Tale of the American Civil War" download.


      We want to offer YOU a free ebook - choose ANY of the TOS house books, Secrets of Successful Homeschooling, Homeschooling the High Schooler or Homeschool Dialogues, our newest title. Each book is lengthy, in full color, and you'll have it right away - we deliver it by email. Here's how you get it, FREE. Forward this special email to five or more of your homeschooling friends. Send it to your whole group if you would! But if you share it with at least five friends, email us and let us know. And NO, you do not have to "prove" it by sharing your friends' emails with us - we do NOT want that. We trust you; just tell us you did it and we'll zip your gift straight over to you. Those who RECEIVE the forward ALSO may participate. Anyone receiving the email can forward it on - and receive their choice of ebook. So what do you think? Will you help us "clear our shelves" of our current campaign? Send this out everywhere and then simply let us know you did it. Tell us too, which ebook you want. We'll get it to you fast.

      God bless you and thanks for your help. Will you also keep Gena in prayer? Doc says her blood pressure's a bit high. She's still speaking a little too (including this weekend in PA), so if you think of it, lift her up in prayer if you would. Whether you take advantage of your free ebook or not, we appreciate you sharing in our good news. Our readers are family so thank you for rejoicing alongside us. We are so excited about the baby!

      Your friends,


    Click Here to Subscribe and Check out our Back 2 Homeschool SALE!


    Or CALL 1.888.718.HOME

    U.S. Subscribers Only Please
    Foreign Subscribers Click HERE

    For those wishing to forward to Yahoo lists or those unable to support graphics, you may send your five friends HERE and it will still count. Simply email and let us know you did it and which ebook you want.                                                      publisher@thehomeschoolmagazine.com

    ~ Post A Comment!

    Comments

    Jun. 13, 2007 - YAAAAAAAAAAAYYY!!!!!!

    YAHOOOOOOOOOOOOOOOOOOOOOOOOOOOOO!!!!!!!!!
    I can finally say congratulations!!!
    I thought you were never going to tell...
    Hence, I would never get to leave a comment!
    We are so-o-o-o happy with/for you all!!!

    We love you guys! Congrats!

    Now, get to feeling better!!!
    YAYAYAYAYAYAYAYAY!!!
    Luc will have a little playmate soon!!!!!

    ****OK, I have to edit this just a bit!****
    I loved what Joci said about sounding like a nutcase when she's excited about something... wonder where she gets that?
    Anyway... I read Paulie's entry, and I must say how happy - I mean overjoyed - I am for you. I remember wondering what Amanda was going to say when I found out I was expecting Luc. You know, she had said she didn't want to do the "Father of the Bride" thing! lol.
    She got me the cutest card saying how excited and happy she was. I just cried. And cried.
    You and Paul are so blessed to have Paulie, Lukey, Levi and Julia!! They will be fighting over who gets to hold the new Little One. Hallelujah! Of course, I think Paul is the one you all are going to have to fight to hold the Baby!
    I can't wait for you to have this Little One, and many more!

    Love Jacque et al. (trying not to sound like the nutcase I am!)
    p.s. I also told Paulie we could break him in when you guys come, and he can change Luc and burp her.... get him all ready to be a big brother again!
    TTYS!


    Edited by JacqueDixonSoulRestES on Jun. 13, 2007 at 10:54 AM

    ~ Permanent Link

    Jun. 13, 2007 - OOH!! The JOY!!

    Now I can Congratulate you all!! I am SOO THRILLED for you.
    It was really hard keeping such a secret for THAT long.
    Am happy you finally announced!!
    I can't wait to see you all again!!
    Hope you get to feeling better and have a good time in PA!!
    OOHH!! The JOY!!
    Love,
    !!Amanda!!

    ~ Permanent Link

    Jun. 13, 2007 - Yah!

    Congratulations Gena and Family!

    A new baby! What a gift – make sure you take care of yourself.

    We will be praying for you and your little one!

    Amy Dusseau

    ~ Permanent Link

    Jun. 13, 2007 - YAYAYAYAYAYAYAYAYAYAYAYAYAYAY!!

    YEAH!! Now... let's see what intelligent things I can say... I tend to sound like a nutcase when I am excited! SoOoOoOOoOOooooOOO...

    CONGRATULATIONS!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

    I am soooo glad I'm going to have ANOTHER wonderful cousin to play with - er- hold. ; )

    YAYAYAYAYAYAYAYAYAYAYAYAYAYAY!!

    I can't wait to see you again! Love you, Auntie!

    Love,
    Joci


    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Oh goody! I LOVE babies! Will I get to be an honorary Auntie?

    A baby, a baby, a darling little baby,
    for you and Paul, in fact you all,
    a darling little baby!

    Abiding in the Vine!

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Wow! Congrats! I think we should throw a cyber party!!! I will be giving y'all a call to say congrats tomorrow!

    Eric

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Hello, I just read that you are expecting another little Saurez!!! How wonder-filled you must be. I am very happy for you and I'm sure all the family is excited. Congratulations!~
    Nancy King

    ~ Permanent Link

    Jun. 13, 2007 - CONGRATULATIONS!!!!!

    Whooo-Hoooo!!!!! I told dh several weeks ago that something was up and and I thought you might be expecting!! And when I kinda questioned the craving thing with the bananas you totally ignored my comment which just convinced me all the more!! LOL! Normally you would have shot me down in flames! We are head over heels excited for you and will continue to pray for Gena especially. I guess this would be just one more reason that we should come stateside again this Christmas! Congrats again!!!

    Edited by deedeeuk on Jun. 13, 2007 at 1:32 AM

    ~ Permanent Link

    Jun. 13, 2007 - ~ Congratulations! ~

    Wow! What great news!

    We never grow tired of babies. Our littlest brother turned 1 year old today (June 12th). My younger sisters keep worrying about him growing up too fast!

    I hope all is well with all of you and your new blessing!

    Take care and MAY GOD BLESS,

    ~Amanda~

    ~ Permanent Link

    Jun. 13, 2007 - Congratulations.

    I might be one of the first to get the news since I can't sleep tonight at all, so I am looking at my email at 3:52 AM. Anyway, I look forward to meeting you this weekend in QUakertown. And it is great to know you have a new little Suarez on board with you.
    Jennifer

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Gena-
    Congratulations!
    How exciting!!

    I am so happy for you and your family.

    Love,
    Maria

    ~ Permanent Link

    Jun. 13, 2007 - Woo Hoo!

    I am SO excited for you all. What a wonderful blessing. Take care of yourself. I'll be praying for you.

    ~ Permanent Link

    Jun. 13, 2007 - Congratulations

    I tried to tell my husband your news (I have told him about you, your magazine, and your ministry), but I just broke down and cried and couldn't get the words out. And I sit here crying still. God is so good--it just overwhelms me. I can't imagine how blessed you must feel.I will send most fervent prayers of blessing to Jesus on behalf of your new little one!
    Camilla Anderson

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Wonderful!!!!! Congratulations! I'm so happy and excited for you and the rest of the family. This is so cool. Prayers, Miiko

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Congratulations! Our family is so happy for you....and thought you'd NEVER tell! I've been such a good secret-keeper...now I'm gonna blab like Gladys Kravitz! Wonderful news! What a fortunate baby!

    ~ Permanent Link

    Jun. 13, 2007 - Congratulations!

    Gena ,

    I am so excited for you and your family What a blessing! Will be praying for you and your new little bundle of joy!

    Blessings,
    Amy Beth <><

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Well, you could have knocked me over with a pickle or is it a banana when I heard the news. So very happy for you all. I did wonder when you mentioned the banana cravings but the thought just floated away in my old busy brain. Be blessed mightily Gena and family!!!

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    CONGRATULATIONS SUAREZ'S!!!!!!!!!!!!

    No wonder you've been eating a lot of bananas! I can't believe this has been kept under wraps... I thought that surely the blogosphere had looser lips than this.

    Praying for your health, ze wee baby and for the rest of your fam! It is so cool that you will have so much help too... that is definitely the way to go! :-)

    Love,
    Marshie

    ~ Permanent Link

    Jun. 13, 2007 - :-)

    Congratulations!!!!!! I am so excited for you!

    We are expecting our 5th baby on December 14th!
    :-)

    ~ Permanent Link

    Jun. 13, 2007 - CONGRATS, SUAREZ CLAN!!!!!!

    Congrats on your new little blessing from God. I am so happy for you. Enjoy those bananas, Gena!!!!

    Love, Tami

    ~ Permanent Link

    Jun. 13, 2007 - yipee!!!

    Official congrats to the 6 of you!

    love,
    Annemarie

    ~ Permanent Link

    Jun. 13, 2007 - YAY!

    Congratulations, Gena! I'm sure we are ALL looking forward to sharing the journey! How exciting!!

    ~ Permanent Link

    Jun. 13, 2007 - How exciting!!!!!!!!

    Congratulations!!!! What wonderful news. God is so very good and his blessings are so wonderful. Julia will be such a huge help-- our Hannah is to little Tabby.
    Take care of yourself and that wee one.
    Christine
    I'm wondering what your next craving will be?

    ~ Permanent Link

    Jun. 13, 2007 - oooooooooomiiiiiigosssshhhhhhhhhhhh!

    what GREAT news!!! it's a PERFECT 7 now for the Suarez clan! i have 2 now so i have 3 more to go.. we on the other hand are planning to make a band..lol your news just inspired me today, children are a gift. CONGRATULATIONS and thank you for sharing the good news! how exciting! i am thrilled beyond compare.. take care of yourself Gena and that precious baby. hugs, Melanie <><

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Congratulations Paul and Gena! What an exciting time for you. We have a little tag-along too and he is such a joy for our family.

    God bless,
    Denise T

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    A new little Suarez! Yay! How sweet!
    CONGRATS!!!


    Love, Sami

    ~ Permanent Link

    Jun. 13, 2007 - That's Wonderful!

    Awww... a sweet little miracle on the way! Thanks for sharing the great news so we could rejoice with you. Congratulations and may God keep you and baby safe and healthy throughout this pregnancy. :-)

    Get your rest!

    ~Amy

    ~ Permanent Link

    Jun. 13, 2007 - Gena's pregnant!

    Yay! Congrats to all of the Suarez family. Sadly, my husband "got broken" a few years ago, so we stopped God's blessings from continuing. Anyway, it makes me all the more happy for people who didn't do that and are able to have more. How wonderful. God Bless!

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Congrats to the Suarez's!

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    CONGRATULATIONS!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!

    Love,
    Amy

    ~ Permanent Link

    Jun. 13, 2007 - Congratulations Big Time!!!



    All this craving talk was making it hard to stay quiet -- tired of biting my tongue (or should I say fingers).

    Bethany (my oldest) was 12 when my Rebecca was born. I have 22 years between my oldest and youngest, and a few gaps - 12 years as mentioned above, then after Rebecca and Ricky there were 6 years, then Robbie and Isaac. Two years after Isaac was born came Addie, and now I'm up to 3 grandchildren. So it kind of never stopped. Love it.

    There will be no loss of love on this baby I'm sure. Biggest problem will be the fighting over whose turn it is to hold and cuddle.

    ~ Permanent Link

    Jun. 13, 2007 - www.homesteadblogger.com/Jonash2004

    Praise the Lord! I am so happy for you! I honestly considered jumping up and down in my excitement, but as I'm due myself (11/8/07) I decided against it. :)

    My parents had my brothers 4, 8&10 years after me, and I always wished they would have kept going. Each of my siblings added so much to my life; I very nearly grew up with only one brother instead of three!

    Congrats again on this wonderful blessing!

    Ashley

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Congratulations! My whole family is so excited for you.

    -Coie

    ~ Permanent Link

    Jun. 13, 2007 - Congratulations!!!

    Oh Congratulations Gena! What a blessing!!! I"m so happy for you and Paul! God is good!

    ~ Permanent Link

    Jun. 13, 2007 - Congrats!!

    Our family is so excited for you!! Like you, we are spread out, they are now 19, 15, 8, 2, and 7 weeks. God is truly an amazing God and very faithful. I am so thrilled that your house will be welcoming another blessing. You are not alone and large-spread out families are absolutely AWESOME! Thanks so much for all that you do. I am one of your little product reviewers and we absolutely love and enjoy every part of TOS!!! Again, CONGRATULATIONS!!

    ~ Permanent Link

    Jun. 13, 2007 - Congratulations!

    I was so excited to hear your good news! May God bless you and your little one as you travel on this journey together.
    ~Connie

    ~ Permanent Link

    Jun. 13, 2007 - CONGRATULATIONS!!!

    This is so exciting! I wondered the other day if you were pregnant, while reading about your banana cravings! My youngest son was born on Dec. 15. I'm so excited for you and your family!
    Blessings ~ Diane

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Congratulations!!! I am SOOOO looking forward to crocheting for this little one! :)

    ~ Permanent Link

    Jun. 13, 2007 - Congratulations!

    and I hope that your blood pressure stays under control throughout your pregnancy.

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Congratulations! Wow--this is exciting news :) We are thrilled for you and your family. Can't wait to hold that bundle of absolute joy!
    Be blessed Gena, our prayers are continually with you and your family.
    Much love,
    Christy :)

    BTW, I thought there was more to the banana comment you made in your earlier post. Glad to know the full story ;)

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Congratulations on the wonderful news!

    ~ Permanent Link

    Jun. 13, 2007 - CONGRATULATIONS!!!

    :) I am so excited for you! I have been having baby dreams and kitten dreams lately... strange, eh? My youngest is 8.5 right now. No plans are in the works, believe me. Just thinking about having to start all over with homeschooling has me scared to death. However, I wouldn't mind adding a kitten to the family after we move HOME TO TEXAS! ;) Don't be such a stranger, Gina! I've missed talking to you! Have some pickles and ice-cream and shoot me an email some time.

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Congratulations Gena & family on your sweet blessing to come! How exciting! I will certainly remember you in prayer. :o)

    Amy
    http://www.homesteadblogger.com/SimpleFolk/

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Congratulations! My sister just had her second baby :D

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    Congratulations! Rejoicing for you!

    ~ Permanent Link

    Jun. 13, 2007 - Untitled Comment

    wow! i'm jealous. congratulations!

    ~ Permanent Link

    Jun. 14, 2007 - Untitled Comment

    Congratulations!!!!! what wonderfully blessed news! Praying for you!!!!

    ~ Permanent Link

    Jun. 14, 2007 - Congratulations and natural help for high blood pressure

    Hi Gena!

    I rejoice with you over your new little one! I wonder if you are like me, and your blood pressure goes up everytime you go to the doctor. Even with 8 babies, mine would go up oftentimes, and I would tell them that I monitor it at home and it would be mostly fine. As I have aged at little (I am 44), I have found that especially under stress, my blood pressure will go up some because I think I internalize stress. Anyway, I have never had toxemia or anything. But here are some things you can do to help:
    1. Make sure you are taking a QUALITY pre-natal supplement.
    2. Make sure you are getting atleast 1000mgs of calcium daily, and try also to make sure you are getting extra magnesium (many times in the calcium supplement), and yes, eating bananas and peanut butter as a bedtime snack worked well for me to get the extra potassium and some protein. (You need good protein to ward off toxemia also)
    3. I drink a pregnancy tea which is a combination of red raspberry leaf, alfalfa, oatstraw and stinging nettles. This helps prepare for delivery, adds valuable absorbable minerals for your muscles, bones and circulatory system, as well as the baby's, and is relaxing. (I have the recipe and where to get it on http://www.fairhillsfarm.com/NourishingHerbals.html.)

    4. Eat celery. No kidding, it brings your blood pressure down. I learned about this from a doctor. I would eat some throughout the day, and always before I went to the doctor. I would expect my bp to be 150/78, and most of the time it would be 120/70 or 120/60 and they would say, "that's really good for you!" Celery does contain sodium, which some people need to limit, but it never bothered me.
    5. Make sure you drink a lot of fluids to keep flushing your system, and the pregnancy tea helps as it acts like a tonic.
    6. Walk and wear support hose if you get varicose veins. This really helped me, too. Walking 30 minutes helps so much if you can do it every day or atleast 5 days a week. This will also help keep the bp down. (Before we moved to the country, I used to simply walks laps around our house and yard at night when I couldn't walk with a friend.)

    I am sure you are getting a lot of unsolicited advice from everybody and her sister, but I could identify with the blood pressure concern, and thought I would share with you what I have done that seemed to help, (along with a lot of prayer and grace and mercy from God!)

    Take good care, and may the Lord bless you abundantly and keep you in His care!

    Chris

    Edited by ChristineRead on Jun. 14, 2007 at 4:34 PM

    ~ Permanent Link

    Jun. 14, 2007 - Untitled Comment

    Wooo Hoooo!

    I'm sooo excited for you! what WONDERFUL news!!

    Mrs. Nehemiah

    ~ Permanent Link

    Jun. 14, 2007 - Congrats!!!!!

    I (we) are VERY HAPPY:):):) for all of you!!! We are praying God's blessings for all of you!!

    Love,
    Angie:)

    ~ Permanent Link

    Jun. 14, 2007 - Untitled Comment

    Congrats! of course I am the 51st person to say those words to you but how truely wonderful. God is good. Enjoy the newset addition.

    ~ Permanent Link

    Jun. 14, 2007 - Congratulations!!!!!

    I am so excited for you. The Lord is good, and He is merciful. What a wonderful treasure He's given your sweet family. I will be praying for you. We miss seeing your family around these parts. I was really wanting my son C.J. to get to know your son. Maybe our paths will cross soon. Take very good care of you both.
    In Christ Jesus,
    Geanine

    ~ Permanent Link

    Jun. 14, 2007 - Untitled Comment

    Congrats!!! A baby is so exciting and such a blessing! we will be praying for you all.
    God bless
    sharla~

    ~ Permanent Link

    Jun. 15, 2007 - Yeah!!

    Congrats Paul and Gena. I am so excited for your family. God is good, isn't He?
    Many more blessings to you,
    Julia

    ~ Permanent Link

    Jun. 15, 2007 - Praying For You Gena-

    I am praying for you, but you have got to cut out the pork! I thought you were worried about being healthy! We talked about this. Remember the Turkey bacon???

    No wonder you aren't feeling well... "pork stuffed thing"? hmmmm.....

    No, really, I am looking up what I can about hi-pb. I love what Chris Read said about everything. You can also get the Red Raspberry leaf in capsules from Nature's Sunshine. My midwife told me every woman should be taking these, as they are important for good uterine health.
    I don't have any info on the hi-bp, because my bp was usually like 100 over 60 when I was pregnant.
    Low stress... take your B's. Take a good one, not just what you get otc at wally-world. Above Rubies had a great article about being acidic or alkaline.Rachel posted about it in the homesteading carnival this week.
    Take care, be healthy-
    Love, J

    ~ Permanent Link

    Jun. 15, 2007 - Untitled Comment

    I know, I know! We are with Jane Bullivant here in PA. She is SO neat (she wrote the Skydiving for Parents book and Dear Lord I Feel Like a Whale). Flew in from England Wed. Last night we all went to dinner at this very cool looking pub...reminded me of when I lived in England. Very Euro looking...but their menu was limited. I didn't want ROAST DUCK (gross - Paul had that). Nor did I want nasty terrigan chicken (Jane got that). So I thru caution to the wind and got the stuffed porch chop. SICK-O city. You'll be pleased to know however I only ate about three bites of it. Still - sick as a dead dog after that. Feel better this morning....off to see Jane in a bit. I speak at 1pm Eastern today so pray for me ok?

    ~ Permanent Link

    Jun. 15, 2007 - Untitled Comment

    congrats on the expected child. I bet you can't wait!

    ~ Permanent Link

    Jun. 15, 2007 - Wow!!!

    CONGRATULATIONS!!! I'm so happy for you guys!!! :) :) :)

    With love,
    Kylie
    P.S. ~ praying for an easy pregnancy & a healthy baby!

    P. S. S. ~ Dad (stevewalden) thinks we should have an online baby shower!

    Edited by Narniagirl on Jun. 15, 2007 at 5:47 PM

    ~ Permanent Link

    Jun. 15, 2007 - Untitled Comment

    Oh, I'm so excited!
    I can't wait to hold him/her.

    Thanks for linking to me!

    ~ Permanent Link

    Jun. 16, 2007 - Stuffed Pork Chop?

    I just got that, out to dinner with my husband the other night. At the Buffalo Head Restaurant. Very large portions - we brought it home and it lasted me two more days.

    High blood pressure - are you staying hydrated? Lots of water. In the book "The Body's Many Cries For Water" high blood pressure was one of the symptoms that many people saw disappear just with drinking enough water.

    http://curezone.com/foods/watercure.asp

    Here's another link for hypertension and natural cures:
    http://curezone.com/dis/1.asp?C0=60

    I love curezone.com

    Praying -
    Deb

    ~ Permanent Link

    Jun. 16, 2007 - Congrats!!!

    I am so excited for you all! Wow, a brand new little Suarez, what a wonderful blessing! Hmm, the little hints, banana cravings, blood pressure all went right over my head. I didn't put it all together until others pointed it out, then had a "light bulb" moment! lol

    Blessings,
    Crystal

    ~ Permanent Link

    Jun. 16, 2007 - Congratulations!

    #5 surprises are great!! Praying for a safe and complication free pregnancy!

    June

    ~ Permanent Link

    Jun. 18, 2007 - "CONGRATULATIONS" #63 or something!

    Congratulations, Mrs. Suarez!!!
    I was so happy for you (and the whole Suarez clan) when I heard about blessing # 5!!! Babies are such gifts from the Lord...It's so cool that He's giving yall another baby! My baby brother, Benjamin, just turned 1, and he's still really cute and small. :) I bet "baby Suarez" is going to be the most talked about baby on homeschoolblogger! :D
    Well, I just had to leave a comment, and also tell you that I'll be praying for you and the baby's health and safety as well!

    God Bless!

    ~Rachel~

    ~ Permanent Link

    Jun. 18, 2007 - Congratulations!

    Oh what happy news! A huge congratulations to Gena and family!

    ~ Permanent Link

    Jun. 19, 2007 - Congratulations!

    What a wonderful surprise! :-)

    ~Heather

    ~ Permanent Link

    Jun. 20, 2007 - CONGRATULATIONS!!!

    So happy for you!! Love the little baby ticker!!! PTL!!!

    Can't wait to read all about the new baby.

    ~ Permanent Link

    Jun. 20, 2007 - Untitled Comment

    Congratulations! This is awesomely wonderful news! God has blessed you with a beautiful child and your upcoming arrival is blessed with a wonderful family.

    Michelle

    ~ Permanent Link

    Jun. 20, 2007 - Untitled Comment

    Congratulations on your newest blessing!

    Janne
    http://janne.cc/blog/

    ~ Permanent Link

    Bookmark and Share

    Entry 653 of 1473
    Last Page ~ Next Page



    Disclosure: I am the co-publisher of The Old Schoolhouse Magazine. All content on my blog, however, is made up of my own opinions and the Home Where They Belong team. The team and I are never paid to blog something for a company or individual with a message they wish to get out in one of our posts. Even my "pick of the week" section is simply a "show and tell" area in the blog which allows me to share resources I come across. Some however, are items included in The Old Schoolhouse Magazine's online shopping cart, which profits the company and specifically, myself. None of these companies have paid me to feature them in this section, nor do I expect them to advertise on any of our websites, enewsletters or the print magazine in return. Any questions? Gena@TheHomeschoolMagazine.com is where I can be reached.





    My Friends

    UndertheSkyMaineHSMomBelovedLambBuckeyeblogTamiTestimonyjulietn3jcarterwswalker310ByHisGraceInColoradoEmptyNestMomdevdoordeborahHomegrownHeartsspunkyhomeschoolspunkyjuniorjoyousheartAcademy252BlogBoyComputerLadyJillNovakleebenvicAgentTimKeepingtheHomeCarlaRpianogal86JeannieFulbrightAmandaBennettamyjlVictoriaCarringtonMamaBugsHappyAppleCornflowerMarieleyecornejoyce,inkmom26kidzcreativehsmomDalynSBadgleyDebiprincessgraceDMalamentKarenWCelticmuseMySmokyMtnHomeschoolBlessedmommyhsTXmomof1wardsswardDianaWaringLeviSuarezkimbercaldwellDandelionSeedsschooldazeMiikoGibsonredmomGalacticBloggerallisalleyHarrietteMrsStevens95PamLacrewchiefWashingtonStateNCLighthouseKeeperabundantblessingslisaeasterlingTammyCTitus2womanStarladyMrsNehemiahSteveWaldenTianyKittyKornerdrewsfamilytxHobbitsHollowhypermusicmomlazearbeamBubsIgDarthYxpuiluvhorsesFimseylivin4Him6creech7sTNMOMTOMANYBLESSINGSBoltbabecynthiarobinamysuekkpratMarinesWifemrskbrookgottsegnetRachel1997HeatherD76Galatians69lullab14Cre8iveMomwhodoesmommyloveFreeStuffForHomeschoolersgoodnewsSomerschoolalaska0girlpro3128EmmygirlGoingRuralMyChildrenAndMeswordsmithybensribarmoorefamknowledgequestChanawildskaterboybikeboy9000hippiechyckNewHarvestOurLittleHomesteadHSinWIDouglasMelkhimomatpeaceAligirlTheCountryHomemakerblessed2bamommymijubrifarmskoolaidFaithfulGracemommatolittleonesLeahwogdearLordifeellikeawhalehsmom2myboysPRMamamomblogBagmankentuckyjourneyDalaimamaSusanSpannMiraclesHappenboo4babyjdoriotIsaiah5513HisWillingVesselgaiamamadusoPattycakeCoffeeAndAMuffinJazzymomTerriCampHomeschoolBlessingstruckerswifeiluvthelandSandlappersueRaesfamilyesperanzavalleroschooledmywaySawickisbrittanyroseConfessorourlawsglmanccmmumTCQuiverfullMomJuldosShaiyaemanprairieprimermomdebbiefromclevelandBethTNAFJen88maggierayesageratsJennLovesJesusDellMom5SonsSmallWorldprincesslynnZElleEllePatinTennAnneofGreenGablesJoelKingzmanJanneMomof5littlewomenSAMIAMBarbaraSheartofvirtuebarrynmissy1972mominpa4beachbabieshomeschool3ksquitecontrarydolphindancerhiplvmom2quietcajunBooksandBairnsKimMCnmhsmomashcatchem97Amberramblinmind1MomwtrmnLindaIjacobsacademyEclecticUnschoolingPracticallyUtopiacricket313girlonfireDuctTapeDadJamiekaylisa062797dragondudeSkipperLittlewarriorchickadeeThePoetsVoiceKayinPAKrowned14HimKayinMaineHereathomeAbiga51JeninNBHeartForHomeDebismumto4wife2elliotwritmmOreoSouzaDirectMyPathOhiotulipGarrisongangkindredspiritMomdaughterofEveBallerina4Himmommyto7homegoddess22wdementAmoScriboburgessclan2000JeanaGToytowntreasuresMSAcademyhomeskoolmomsnider6intxJJOligerRebecaREInvestorSweetHomeTennesseeBritishColumbiaPinkFlamingoSimpleMindedMamaLearningGloryTennesseeWisconsinTitus2MomTRINITYPREPSCHOOLLovingMyBlessingsdeedeeukSheriAtkinsonMileshouseAnnetteHeidistjohnSupComTabzWalkInFaithnaturalbirthdanibmrssulliHomeschoolCPAaskkorndorffheavenlycreationstelmaranyachristinemomofseventheblessedlifeCommunicationFUNdamentalshumptykympossiblemamatccakeandcamprairieflowercfloridasunsetsamatthiaBookFreaklattegemsMommy2fourCsmattzach42cupsOjava4medogalways524iluvmy3chickiesandtheirdaddy2EEEEMommyRollsLifeNOSboy11sajolleyhappymainemomStephanie10Stormimayhallfamily8homeiscoolOurLittleSchoolRoomsonshine4uhope4moreSandBetweenMyToesjennfromtennsmlltwnmmmyBearingfruitrjdjohn316JocelyndixonBeccaFaceSuperAngelJacqueDixonSoulRestESonly4himblessingsaboundMarlaMomHis4lifeamadaTrinitythecoolmompianosteveEquestrian4HimRugbyHSarajbrownSingingANewSongBlubberBloggerskidsus8CandyFooteBattlementsofRubieshomeschoolingmommaof4KimMurphygabalotblueskiesandlemonadeWoodsandLakeskblevinsmom2twolearning4funmamasmurfandijeaneKelleyantelopeheadMasterWindutruthfulonepureonercelliottihopeyoudancesdzsmithMrsIncredible4evrHischildSarahLynneTheresaMarielolly01AlishasbcheaAussieinAmericaHaflingerhorsesBlessedmommy2fourjoedebbyourlove1babymakersaCleanHearthodgeshomeschoolSHMILYtimetiredmomJocelynJamesLeigharev2servingtheKingofkingsbriannashperrychristianschoolNotebookingPageshenryteachersGiffordBabyJournalbooknhomeHediedformebelovedbookswabbahJustGiveMeStarbucksRedFireBallmtnmamaof4kennedyfishnetherfieldmomVictoriousOrangeGirlweare3Char5BChsMamaof3douglashomeskoolquailhavenacademyShariHisAbidingLovealaskahannahRedbudMOMflippedisWOWSincerelyAmandaTNLisaheldinhisarmsoflove24RuthMaterdaredheadhomeschoolhighlitesKeriSoCoMamacitaLadyRachelgracefullAcrossTheCountrymakingspaceSandpiperMooseBerryMountainagodlyhomemakerpinkginghamomNarniagirlPoorBoyHatMcCHEOtrjpublisherrobinkayangellwavesbutterflyschoolmomTeachingHisWaysPricelessPurityBlogDesignbyChristiPatcheslivingsacrificeteaching4forHimParaskevaposhred1Trinity2PlainJaneMommybobReviewsbyHeidifloridamomto4msmarlanikkisimcoxMarilynRockett1ITeach4HimpuppydogtailsPumpkinsMommaweesmadebbiecorleyturningheartshsbliteraryclubsockmonkeyLukeSuarezMissPrincessnancysnookhomegrownhomeschoolgoodstuffMamaMahnkenrosegardnerdiamondsintheroughmoreofhimpottershandChristineReadcminsoflabookgirl07MountainMommyreelmomof4JamieDalessandrastarrblessingsundreamtofgeeterbug5loreoAmanda10AxelbysolidrockhomeschooltulipmamaFravelFamilyCapturingMomentsjallionguitardylanRaspberryPixieMuffinMaidenInTrainingRDFLEMINGTalyaTWaldensPlanetBethStoriesHeavenlyImagesMaryonthePrairiedomesticangelmommymareLexielou972rainstar13GotGod2200StormSpotterTaylorMariekatpappaproverbsmamathenewsAssassinstoryteller07Samanthamelissagraceprairiefanmichelen6Liwellaluv2bUnderSunchatterbox324princessgirlyesavymommy4kidsdunnNomimae4littletreasuresHschoolerJolashKIERSTENOBL1V10N1337GangstagangstaXxXArleenXxXHotlipsoutcastprincessjenny101soccerdude13Kathleenangeladotymomteaches3Michelle96appleHomeeducatormom4Cyndamandymonkeyrswinfreyctownernov05mamabirdyEnisgirlnatchan12aadamsamystemplateblogssunflowerfielddannyevinsian5zacsabamafanjordanlangleyskeetergalsPrairieMamaMrsMussomichelleradonskimkrmarkssrhubbardMommyMiageniescrewgenieskidcrewcowgirl101gg12sahmsman007preppyprincess101prepprincess101princessprep101Chlozorosewilliamsdaydreammom1legochristianthesoftparadeTheStoryZonebizeemommywendiesiouxrockin48kingkongSCnsacMoneyPennygiadajadesunnyhoneyMUSHOyenokidakidsmomElliotcandymakinggirlalwaysus3luckymetxsmiths6CarlygirlEstrellaEnchantedFaithchick123skipper30AlexLyleteacherbrittmshart98HentyfanhotmommyTrishaHristerockinforJesusMom2SelenaaarontethantMissKirstyOnnie76MamaNavyBratsupermumsyolivemamaOliveTender5bonnemassk8catemom2queenie2004ksaundwewinnowstylestar101KrusemarkFamilySuzyPracticeSome1AndreihewybreitsmaAPHSmomx2Lammiesdorothybaueralbaymom529beaniescrappymamaLMBMommyof4bevinwilderkarendawsoncojudySunshineboyCapableChristina148SuperDudeBreegancoolrooshelteredDunkallforGod10TylermskogenTluvsEchuckyrchallbyfaithkaylieJohnstonFamilyweiserkemtdastrinity1316reflectionoflifeClemonsskochanPoeticMaidenLearningAllTheTime2mjosburncreativeclassroomdktgrannymomtomomjoyfulivylittlechildchristiangraicemattoxBeckygRyansmomMamaJennyRoxanneBamericangirl26BackwoodsMomKiminNJcaffineaddictmik6Homeschoolers4GodShintaJackLaima1jandsmathissarbethhorselover1993meganc8539bardsanddogbrainlady5intowMelissaMomMamaArcherimperfectionTemplate101momto5blessingsmamawooksisaiah3321bboop2000canozzieMike2387BlapherMJWheeler7racheljalmasthunderbayranchmenzergraceanniemlmommy2ktdalauraofharvestlanejordanjuneaujosie4ForrestChatWithYourFriendsraesfamily2kristenkeylichslenderHubbelledandcyncaballoamares1993FunkyPunky95free2bemematt1121bDolsonmymoviecostumes5and5MiyavisBiggestFanlittlelauraljfchsthebrandtgang91hsmommymagicinmusichomeisourschoolShayBAriellay2kLibertyAcademymammamoosecuazcristo1993troushBCreativeChristianAthletesTootootqueenbrownshugatestdavid2Rjoyh2okimmyandgracielightshinemngwaamymclosemcnlambsjoyfulnoise2007DollyAndMeprettylittledressesAfternoonCoffeebrightpathsacademyitalymomforchristgermanynetherlandsgypsy88bensnh6packAbsCairnsleviautumnfiddler4himOutLoudTScottbhenrybookworm8813carriejgeightisenough2ooprettymama381jeepfreak08kperfairiemom78maddog96gracie1of10homeforgoodRainyday720puddleglum14Heather1031sealedheartsboxingiscoolHomeschoolingmomof3rebeccahuffringsofsaturnbayleeboo96Redberry40bloggsarestupidkkimbroMissionchickCrazyKalebamyestesRaymamaduckaimin4heavenDemo8338BFFsforevea19AprilLooWhocountrygal911epperHARTSforjesusT8ermommamelinathesweetmammacntrygrlStartalloverroseweinerrunnergirlaussiefellerlilimolinariFanaticKimcoTereasaMonoManmodelmir13JsbabyMicahsixeightstuntmanRosethornluckybrats96Avinkarascalsof3chucksgrlMighty41Hkids4christxtremesoccergurl88kateroo22servinghim4everchristianmom35sebastiansworldlukyduky1992lkirkwoodhchristianacademyhatepinkpearlsofhopePsychfan109Thursdaynili2012lrw4faithwalkingmomLulu98CindyJJbusybeeoffensivechristianPeaceful5luvhomeschool131AustinfromTNJimmyFromTNAbigailfromtnsiked4GodneedlesandthreadlainiekinzgreeNeyeDgirlPrimaBallerinaTonicrazychickreddie2teachsearchfgold6789RyGuytmanCountryKellmenetekeparsin730therileyzoodbaLawsontroysastolpHisHeidiCKMcomputergeekhymnstudieshighlycaffenaitedGypsyTaylor106specialmom42000AddyRuthTestBlog360jdorrferballMustSeeBlogspaytonbauerbananas4jesusatmercerSkittlezfreak101gonewiththewindcamocaring4creatures94alexiamiguelMySaviorLovesHI91acredhead113bff9493prayerworksmgarrisonsecondtimearoundmod2vintpinegroveyolandarenee34kaylap10flutterbygirlallboyPrecious1MissiegirlbigboysdemoblogSimpleTreasurestisha246inthenightkitchenlydiatanOcarinaMomsweetpetecheezitfreak101jblovetsmotherof3alagasiaHowdyJulia1617AizeeLaureloveJTurnerGirl1denhamfamilykatiezmommy2000TheInsiderRusty05billiphollywood15atesterclosertofreehsmomkikisumguyMacMacAnne12sportsboy98dragonrider72Jeanarbean5cheldelemsbingytomfamilysraykingheathergcBestFriendsALWAYZ2SuperScotdecouxaheavenboundkimfutchDragonkeeperstudio43misteri5sreamochick1HappyMumathomeLizardmanJackiHigginsgymnast4evaCarbo116sgia2SavedGirlhsirt428zzzzzzzzzzzzzzzzSkaterKidhelios1rfrandallmindyeva7rocknrobininHIShandshomestead914CountryMom2MeggieLittleSparowgndksmithhorses4ever23vj1021mihaljeviclaurenharrellbethanymichelleMcCainmariwichterselfdramaqueen1lmphinneywesternvilleraybelle12Jonas411CookyjustonebranchPrettyInPunkrachellybelly123jukabe3lisasblessingsAbbyigaleLilMissKittyPennythriceblestravenhausvwfreakmosleymomMamaof6PirateChickhoppefamilyDebbieStentzelmckenziedgutierez1slawson66ThomasGate88Getteerikaelijahjo1rockyjghsgdoodlestemplates2SkatingFairy94ShareBearnicoleshousebrightpawnicolew14happymom38ChristianYouthBlogPrincessgirl772asimplemanksmiley4christAbbieScmcourtMrsSmileMelitacarrierellampnauthorgwendetjoeycody123ElizabethJosephine79Hollymae91spunkyhomeschoolgirlspunkyhomeschoolmombigdogof4OpheiletesTryonReadingmamakendraWay2crossupstatemom2bullardacademydawnmiketzJohnPrio95anneelliott2blessed2stressHereComesAnotherOnejunkfood1manders10SkiMomshagy101colesfourlbcm56ppp56kaybear3kburnerbetsywriteTheTeenScoopzookeeperof9kanpopedlynthomasfchstestbloggerwetouchthefutureadamsribCyrellyscoxkidsbirdboyBubblyChick101mrsnickjonas816volleygirl24Kristian431abc102549Kristian431abc1sarasusenrmedina78mgeis01BlairSprouseBluenewelktburchell97MommaCrystalabcdefgMum2KandCemavj97sharisnest2roberson5RachstersSleepingBeautystarskyfadedmemoriesjustusgirlztoodlesshepboarderdudescrapmommy2HopeCooleyhomeschoolmom928PreciousNothingamyoz02MichealMyersbishopmomfruitots9MARAMAE32jessicaburkhartweadockfamilylostlisa00EownynfishsamBurtonTravelerspokemonkimjennybfakatiebugpionergirlivyvega25journeyintoRobynanilorac08mamacraftspazzaacadVannessaHerbgirlNickole1legobeardrkjallenAliveinloveMarsmarcsstar5jengriffinsharkaly4483My3homeschoolerslearningmomMummydrummerboy4lifeKate124JoyfulFaiththorhammerdarlamckenzie14lisamwardDesireeAmberlynnstampedwithgracerollinsjenMeganNicolemamakarenfaith4usmom24wondersHirotosahoteMrsDrPepper2324Dbostonprissy0099sonyahaskins5xXxSweetlyBrokenxXxBrOwNMoNkEyfaithfullPuddsjoeysblogJakeyImaginepeaceNana13GraceElizabethpreciouschildrenegl4031LittleLambs7000zuskagunnfelixpoeTeacher1hopelovejoythuisfsn119jamirilljodenSiahjamesMeME3videosMDP232canuseevancliefalleyBeautifulChaosrebekahjohnsonmomoftwinsmamamckenzielaughlines2uthejonesfam6imaginationmommommatothreekidshoopsandyoyoladydellSarahBuddy700somthingmommyshugarscottonpatchQueenLydiasheila91788wearebroken135magooKidsfirst1Kidsfirst2BethHowardJoBroGirlrellimallthedramaqueensilvertailKCR5liberlivingmy5preciousangelsMrsNickJonas93magottsWendylhviolinist93Bigsistashamstyhcksfernandoriverajr1973mickydw2002NannaBanana91Supermarioshubbard25165VickypurplepoptartLauraMcGtkd1238TheophaniaBubblinMomxxgothicgrl123xxDaydreams25jkenney1973Mindyastimegoesbyjunebuggg86jenmarcusunwritten123Inthismoment95havillpsillygrlmonkeybusinesssunflowermommypsalm1mercercafewhimsywayduley76samnashMcDonaldsmississippigirlChristianjazzymomPeacemakerlucy1239895thespiritoflearningjoyrrhkpbreffefleekerabbgun11MeneldorCherrytheXIVrellastellyelifesclassroomGrasshopperWrighteousMetFanPippinTookLainfamilythreegirlsChristieCsorgenfreiscoutsonthebibbStylestar13Tripple3eFlybabyFloriantwinfishhFreundTest111kbb1109emosauruslabrownmelissasunshineMosslegspatsyhinesstewarthsinbelgiumImagineThat25cbandlowthelordismyshepherdjulieandtheboysErinMajordancer26sam2008JediCharliemhamstampingsamsurfingkid2xxemoEgoomichellynsupergurlCroutonssparkledivarenaissancemamasnugglepeas29PipinoftheShireCPSTmompippinthecuriousJessicaLynnCamposmamaannadash456buzymomo7mkgillioDonnaSepellopauline3283mattcoolguyjesusfreak13jchantrillbluerosemamaxtremesoccergurls21SolidFaithathomewithblessingsjourneywithloveJSCASMROSEChristianWarriorhelpingmomsHalflingsibs1011earlyriser430amyseekelldfinkfrommelissasdeskTitanicGirlBrokenPotteryThePuritanmyheartshero777basketflatmyheartsjoycelinemomtomimejoyfulannateachingmom08jananxquisit1ChristineHsewmodestkrgbbwasingergirly142earringplusgirlsgnatsmommerryann38lunamamawhatsup14loripearcelovelyGtmjfamilyMileyCyrusRocksLadyArwen12homeschoolboutiqueJunieBugdreamlandccmckowannightmarepg4woodsdancegirl17NHKelly99SkylineSkoolerNear50shutupandlistensmiliesphotosbakeandcookcatheycornershawtymal99RoehrmommacoolKari10RacheyBphai1484twobitford008NikkiPhoenixbmxboy123bigsis2manyTarynTrixieTheFoxharrisheather22LoraBethGirlsBestFriendRightHereInIndianapunkymonkeyLittleCamby9DeNieceBeachluvngallegalMamaJessCderagon1Reborn1jillybeanAcey1234miradogcozyinthewoodsConfessionshomeschoolingmy2daughterofchristInNarniataniosetfreemaideninwaitingchrstanmomCaliforniaGirl101keepingPursueraquamarinebeliefinthetruthKatieMacelizainnesleeu101hdn9587laurapadalikMomof3inPAnopottytalksydsmakhbutterflysweetnsour229donnak4ffemtmomof33JsLivLauLuvduckygrl12pkgundersonelecia1996LynndaTlindorm235abercrombie865noodlebughsmommy3g1bMomsloveJoBroPicsnenei86Jadesimply42BStonehavenhomegrown5angelsdustfinger06Fitzjesusfreakteensrobinbutler39freyjasgrace2momMistclan1writermomlulu8monkey6jesusgirl01melindacabMrsKaraBrendaAtHomeDMWLEAPAdminenteringwomanhoodtawtenereJamoswifetptosryanaltShaunangasolinexxheartjodishellmamasweetslinda4u2008ram51881bronsky5dexterswheelMichelleRothwell77flhomeschoolmomsndmcsesarasorrellshanshanfuzzyfriendartistgirlryanhallMamaDuck23DucklingsBeckerzblessedbyGodchristine15DelightingInHimunicorntkkangasClassywinterwierdo12princesseshungryheartssnmom7redheadstnhojbellvillejrose79agriyacherylnovakWomensMuseum08leahchristinadavidrice15goatmommaFooteAheadroseretrouverJMariebubble7017theemoScarymaniluvwritingArelynjkingsLesandSmileySushi76179crissymousemilburncountryacademybenton7girlsrockcdhjmarshsheagang6testinggirlMaynastyaandreyovnababypattsHardRockPunksisterbrendaypwifenonconformistJohnyTobez24kbkkwhitneyteamBrandymeistercherylramirezKatieladykworleytawniajcaptainofgondorTreasureHeartjenjensopranoLisaMarieJrobincrhepiphoneLuvMusichsmomsgDeut67ZappaboysamosAlexis23Bllexylou9blessedandthankfulLadyMarianExsulisdeCambriaaaaaaamountaintimes9schermerhornrocksjunepvintagehedgehogbuzymommyadelenpaulfarnorthfamilykoalamanjereca74nene2fourboystricklecreekfarmSandaykatiebethandbaileyAprilLDBackyardBeautysosweet935happymamaof6jjjreedjflforever21bornagainreneewoodlakeacademyStarCatchereNewsbunnyhoptripodpiratechickarairai123mckeldhomeschoolmomof5annaksc1Gamom03jdaleyscmoviegirlstompkinsdcellismomabeanof3ginggg29LittleAntieTammysSpacehannahmontana101smithrvadventuresmmasenheimermamax3angelsdankauffmanamyquarrierkmadisonakaratecatt14purplebibleMistyLakepsychomonkey926nascarjoeyKaren9nevillethegordbookofmanypagesladybugluverHHoffnikidustEyassRebekah62GirlsRulebookwormauthor300StoryMaidenLacybcmm85CranialHiccupschloe98AlyssaInWonderlandkatie96mamaduckof4imnotsupermomDrowsyWatersJstsherblogpress73KelleyMomof5ShadowLinkMommyTeeMargueriteholmes99dahn2932lucychick18WalksonCloudsWalkingonCloudsraanibmhurley1boysrustestbug030298JustMommyBarkjonSingerssitejessfinchYatoesLDudeslink1211magnetnglueMomofcndamccollMommaB24kcschrammCassiecat322phayneshannykinz101happyhollyLukeamismusiclover05wolfavatarbranwynjoker9145raysoflightAlabama13happybklredareddingcoriroy667ThePlaceOfPrayVartanleximrcoolsnightmareNickylibbyjessica2gamelordMattR10259smithrobertahsingmom2fourGlorfindelnina8900bittersweetjazzabbycamlarsn95023fccentralpdxLuc7mommy2fourMisyfoxprincessarielshallidaymaidenofvirtueEleanorTell20fanmariellamurphyalikatts323Savannah4HorsesjagccutrightGracie92anniedarlinsassy777888racheldenningrositasramblingskarismishinraleighBarbiGirlvb09pageworksbusybeetoysMarchmamaHannah13mommatimes5ThatKidkelsishannan2011jhall984HSPassportLizzysmylifeismylifecrashMarie1225wanderingSummerridiculousmomTypingfastthornrose7amclaughlin9DawgDebbie4JCCHappyHope1isleofskye7dgfbdbrettmitchellcmtgirlmnhmslmomca16gymnast414JessLBeeStreamclanBlazerkidtrinabambinaheartstogodburdickfamilyPiratesFanClubhappymomo97jedihamster007graciegarzaJeanie1jep915GodsCowgurl4ecowgur4lchristSuzySchooldosofamLibertyMom08aristotle2ndmomof4babiesCindymathews20carmenriceMyPrivateJournal13mb13PickleEatersanchezcelineswestfallacademydaciacappsWeebokelbellejesusfreakkidzAdrienneLmessengerofchristlalalandwilenschooltdemauro77LoriDon34391325DebbieKkempiakLittleWingsandave88fireweed1988starrghGoingyeepEmmalemmalyPreacherswifeGirls4GodmjnmissieSojourningMamadougalsmanagerkcmomof5mamadingAzrael2112314LynnaIreneadlerASloane700faithlutherankelihuwer06paulcindy88grandchild1995danielfamilyAchaelessadiebabythatrachelpersonballetmom2000iloveshoessnowgirl14kcmomommyIsabelleAflywithme8rockstartestingelvenwritersportygirl95samiam1972EmeraldValleyCaseyFoxTheaterGalsJnathanEmmaSheena2004ZamuelCCJJsMamamamagooseBrit91MyPathtoProverbs31dazeemkelley95Karsonb101lauriebugDylanGoldenShadeaepetJesusfreakHannahkleinmeisjeJadaBugtwelvestonesschoolhighkingisaac95MstarddwoodsvmorrisurbanhomesteadrobertmurphyRescueAnimalsLives96oliviaschomeschoolgrl15MEandCISCOIveBeenRedeemedrhondanpeggyrmccormickbrianlvetaytay258esmith818jesspowersvickiekileyjrbullrider14Pinkgirl101ptownmoofusthinkingforotheriderlisamgurEaglesWingsMamalss2008Debbie1175Joni4HimmosesmkcAngielynneJustin98MyPreciousGiftsdenisewillmsAndyRootorrboundmymadakajaHannahBanana95duckygrl13LaurenMarieDesignsM1ch43lpatticarricosmc00LadyJudithBlended1BadMamausmcwfyPuppyloveMagcloudfamily41princessstephanieacssoccer02auzdiwardogBeccahNicole93blcSkye5000sierrareis17akfarmgalBaserunner708DragonJohnjandagowanshannaniganscarinaScreamoChik14masterlink2323Wolveswymomrugrats7zeerayGablecarpenterskidsmiscreantmadge1sherrywardmixedwithrainPS13913issaClickOnMyBLOGhubbardJoyce18silversun74SherriSkinner08youngshsfrogpondDiamonds4Himriversong14coolGFSamisIconsmindlessfreaktrey2tthomasacademy1mafamomNayfiesMamaNotPerfectdarnelleMetsSoftheartJonasluver8976twflegerriggsfamily5wellington14pandora99mammaMooreboodlesmomdickensCawfee7davisadomvillagerachbranchlovemypies23MotherNTeacherof6crhrouzjhilbertbellecruz29boedusqueWOWnoahgobleTheDrawingBlogPaulaMarie3nancherrowluv2skatejeoffsribapurposefullifeHoldFastLivetoworship08Brokenfuridgrassertevans9973NataliestestblogLeftytoo2ellie78captured4jcbncampbell1laosbornebroobsdhchamaslalunokhannumhsmama2think2learnCreationClubTeacherHappilyHomeschooledKidchaorTeamKautzdarkkilersAmusingMichelleDrewzCluezwisdominthemaking4bethanyjoythewrighthouseKendalroxygirldarksecretsargmatt1996wekeepgrowingnellohoylemomparzi3Strive17gardenmommcdougal2002LeslieandCaitlinstephanieyjazearaMissionary4Him2jerseyzm1998teekylesmos1430CountryGirl96gabriella17190horsegirl00PAHSGmammakelilluminateCityGirl564mifam4jcchrisnkelleyrobindfowlermorningacademybrookebpPhoenixRisingaaaaaaaastjongyankeesdude101Ditontocatgirl999sydneywolffuptonCaitlinFanClubTakeaTemplateSnickerdoodlesavvy1whitefireHancarhollyhillsacademygmwb6968EtemanStupidguynoelzVintageAuthoressIconsTinuvielTigerlilyHardbottleMalldeathqueen22EspressoHotshotholycrumbsbuttons3ProudHooahWifenana2chasejennareimomtosixsweetiessalazarmotherof1andluvnitMary1993testbeforeusekateygracegr8catePaulPat20085dolphinsrattouillejonasmomRedwallSquirrel23reinmine6grandmajhartz123MaidofVangelyapurifymyhearthefeelslykaherorjangelforever20littlereader7Jessicrittersusannewith3mylifezxcvbnmduhuknancyvjNobleleadercgburkejens3lilluvsfootofthecrossszatkowskifamilymejia6DebraGowl1861desroyersmabDonnaPatriceCodyMyPaintHorseevdNicksmom3dragonhead86quyncihomeschoolingoneEsthermayMeg1luzmicci4Godbluestarlukeskywalker98princecaspian98katsrmylifeBtreemama2to3Nokydstowell6yokotaNesscheebohdnaitkenLuckycharmsblessedjourneyssecretagent95kiricutieDestinygirlmidwifemarmielbkgobble3ArabColtsnigerianmamaSoOoONinwaiijlmoorejulieclemseventhheavencourtneynbabyGfiveawesomebloggersBlessingsrosekatJennyinWIMcFlyDrfroggypantsamelieposhklcondryandbldgibkellybelm31178dairuby1988bljfamEaglethemageditorAtHomeWifebraeFaithfuljonesfarmjeremiah2911thecooksprolife1bren1122watchWhateveracademyhorsegalthegirlizzieCordelliaMirandaPdcnewarkdenicelgdalynnrmcnicolewilliamsfullhandswith3Spiderwomans44soldouttojcTKsSis97harmonydawnw21m28armymommyKKJustJennieFaithFanClubAprilSmithYuisHSBthekingsdaughter2008CountryChickWereJustCoolLikeThatjesusfreak97angel0305Xenia2345HappykicksstuckahomeschoolerGabrielStJohnMeitykidsfaithful1averystoysTurumbarlesliesusan1dablackoliviamarkandshellyhalmarjoyinmyheartthelambscottagelivnlife4godKateOMalleymom2danhanmommalannReadThisSummerStarfire13smithuk6GodsLittlePrincessPinkPreciousmimilana27201Footeyounggirl1995webkinzevesdaughtercaratcake27slmdhmacPinkDaisyGirlfuninsun95nenurosebudmomInMyWorldcooldude555digitalmatthewlindajwilsonzactlinBirttalurp123dusticopiergatorrays3slcresslerpitterpatt4BlogTips2TrejohndpetersonhomeschoolkidStuartDimmelMakingOurWayaussie13girl5yelyahJakeonmarsMorwensweezea5EmilyRoseViolinTulipallspencer79bookworm2kevinyangarleneConstanceCanterbrassthe50calcarolinajenPhlpns413ChristianteachermomDixiecupKitterman4intheFOGsonicellisbeePrivateDiaryBWOGvaleriemeerssarmartindalelynkel5KLuvraptorracersVictoryAnnFarrellMamasgot5kahulamaekathrynwaters1MarvelAnCafeBloggerTeacherMom5MissModestJKSaenztjekj01ponyclubgirl113jolenegreenmaryatheartjoelleebeanlilyflower10magpiratefuzzypenguinIggyrampratZLoriespinboysflowersteachfamilyoilsBrightHeartdoobearTiffanioneeyedbanditthecormierclanBlessedByMyKidsbrittcoriNew2HScaptainjackfreebirdmomGabiCalFrancisButterflieshotrodHadassah13redshirtguyAuntSharonsparklediva377TracieDSpazChatsLara2of6ArmyWifemom2my3sonsbrans5kidstalkative4Godartygirl11donnalcoffmansjwoltersNessPlus5whitcoreybsorccountryw585PKJesusFreak1ofhissonoranstamperpurpleshutterbug11GrandmaAliceantipinkScrapbookQpdalleydiamond101ladykatePrincessCourtney96notenoughtimemessymaci77MutranBookieWookieKalinabellemyskyekaitlynn87crystalrox57ayala76vickfamily007booksbyjanicechallmeyeralwayskobrinfamilyMade2LovevaliantxxthecakeboutiquedeedeeaustinRfromFLhsmominWAmomishome2gamerboytraceface329oxoxaedanalexasthom99NauglerFamilyMercedesNoelleMenaIcons4UTessilamaryrfances1991Shanilucia2moparPsycheheart2handsjeninomahaJessicaBmommato6WelchFamilyMandMScalesHSJohnThomaslilemmyMakaylaJoRifTinaWittersthehorseygirlDanielDudeantyler15solamommyTheNewGenerationjordanschoolhouseclp11mirlenspace86rachelgjdthandmaidensofthelordginastroupeanitacs9101askmeyouseeb1a2p3krains1samueljwfaithfarmoriolesmagic521royroneeMikhaelPRAScholarsNathanRocksdeladybugRaeStrider4himDevotionsForWomenSNOZmomgetbir2007JaychadLoveGirlyThingsNessasCornerNessaCornerdandylionknitpickballetbloggerskyjulsmondayprayKarissaDOEProverbs31kerrilynnhannah22mrslilacMum123GilbertfamtericksonDakotaSoapladydianefoxmdMy2LittleStarsshdaisyVivyumanjoellesoccerFieldsmich3lalalizzy714EllenMKeyeszaksmommybirdbrain28jazzgurl9101writingislifeJeanSkirtChallengeprov31rjDWJWDcheryl44southoftheforkjenniferennyhomeschoolnomadmelirnblasterHorse234mariannerockonAsheCypherKellieinNCelizabeth123PainthorseGreenTeensVoiceOfERNmommasgoodiesMom2dankelKinder04beachbunnyGodsCreationnatureboyJakpattersonfamilyhomeatlasthizprincessTheophilaAhsmomandboyjcislrdewb68SarilasEvanbobjeepmanwillmonkeyhippo9ikemanrockshelamanacademyredjade2000dotcomHISBuckeyeSoonerstwistedpineknutsen24jennzAudwatermelontttebLotsofkiwiakwaldtSusanByTheGraceOfGodstandrewshomeschoolMomsTnSaraBearladyirishbeekmanmistertigerlilyorstColtandFillyjdg50LeapordpoolautumngraceGodrockzQuill159mmm3lemos6emily1715PinkCactus9LittleSparrows5of14bunzolacemmysmomPemberleyBrooke9NeopetsscarneyCourtneyraeinvestercperkins2funnyauntoutofcontrolkoalabearFuchsiaLibertyTreevanillacherry43jasielkathryn77718SpeedySabinHighlandLassbethanyr79PACSmomsillystanleystuffMonstersweetness13froggiekidsloretta2of10JamicenotnormalAbramsErintestsforaiminghighJesusFreakPK24601mikettydrbudlymmbrunsonjasmineatormrsbearwhoopenstianerGirls4GodAcademyNickiTruesdell1nursegailHenry11TrainingmygirlsforHimMaybabytabicatLeDiegocloverHastingsHS4Godloulou30281blondiejewellgelpenprincessThatsMyGameSkyeWriterpeanutsisterTruehartTreasuresfarmerjaneshirleytemplealphanumericmomtomaddieRedmondKaliSprocketToedoe13anytimeforme2taylorztrioTyler210cjalforsTreecoalnomadsNickJonasGirlz3grubbwormssmjohnsonPrincessbuttercup000000hannahFruitoftheSpiritarcherbeaLostInMemamato5littletexansthe4RsRootbeerFloatFankoneillcfb25QueensofCoraAnna93cwalmondsJuneCleaverHeididogctmclub01flowerpower99Marmadukemollygirljt89WabashaLuv2sonlighthowardCassiespring6cathijk2steffaniepavegutsWalkingInMiddleEarthhaydennblondeeLadyTirzahMammaGirlshipman5Britbratttx3glamchickaroo101Michaela91morethenpretty123pwsoundsoff1funfamilyour50greatstatesHRHcasalucehomeschoolgarciafamilyTrueblueCountryMouseliltxangelShmokkey224JoBroGalPrincessStarMobius1lattes4everthewifeypootsucheMYGOODIESalliecatbigyboycaleeb123cerasilverpalmtreeBrotherGreg144smile94SimplymomsomethingtotalkaboutSavedSinnerilovemefsupersonicGameGirlsummersgirlorcaprincessImmortalisCaruswarneracademymarchella865CharleeKeltobinKathleenSLPPrincessTigerk9coryBakerBunchcc7kalelaPomz4uOkeechobeechiswoobillykim92mattizkoolliteraryhstuckMaryanskiKidskennaj96SBCORGIsghaZdogsrule999PlettATDtemplatesKidsofFaithCoach1016Club234SnnyRainbowbabiesjonasSalsWifegracefilledwomanwarriormom2abmangieshumwayOutsiderazertynarnialover95JaneDoebutterflyqueen97EmoryDonatello7582JoshuahammondCherryBlossom777Just8HillsgodspeculiartreasurenemaflarterARLPCthegreenteamsgallosixteenstoriesiluvmusicbillbernatlclevelandluvabookwormLizzy4124TemplateTvmh47bizzymomfiveLindaBotkinNinjaFairybuggymajotwilliamsonunfoogettableblendedfamiliespinkladytemplatesFuseFlypawsandclawsalenescountrykidsscodebderrcalcamusjslisner1KittenGalAlouette1968Cricutjjustuscamilleebugmikmahargnrhager30frenchfriescrazymamap2DustyFeetprfrming4jPuddleJumpersLizreeveskentonNATNAT828mamawarrenGodlyGirls101elseenursemamaof5vintagemamascubamomHeartLikeDavidjbrucelcacheerleadrsmitty25Garrettlutheranmamaunschoolermyselflannon9JannysupergirlpurpleunicornmojmommyPhylicia1521khdJustaBranchrokkaztoristreasskaps5ADHDDIETStephiesblogjransmithmyheartchildrennancarteramp1010her4thinstrumentalJenaCivilWarMaidenjennyrayeRickyStardebbiemerrimanGTStomnjerryPrairieLadyHerbseaglesnestMilkyway8491AptipherejessicoltenFireKeepersharonfaragheremsjournalxXAnimangaXxmeeshNarnianQueen07legacyclubsjudithalleerobinstokesmegamanboywe6belongtohimkmgibsonsplitdeicionzdmkintzcearasweety01missyferSusanL99sandichellechercyrriddler1crazy4horses93ilovebarbiesathomeinthecountryjamieof5Sprinkles96Oreocookie1jodyjarvisstephanierAlwaysDreaming2much2doLeahFlowercoffeefreemomiowashellyneenee838creativedreamsbeccabrookswifemomteacherduncan917LeAnnesoccerdivajcmlasAlohaGAGirlDoodliedonnashepherdMeredithCurtishsadventurekittytenshihaileybugRedStringTradinggoldy36veitmscarlettsmoores9NaturalFamiLEADashFlashPonypartyMAMG4HisPrincessBelovedjeniverwboyerSingingStrong360javedikianTrixie23kmz0132seise420BeautifulMichelle92glitter54cheergrl23Tracey1211ActsMomStorytellerrutlyfuldancer011195D1mhShawneeHomeEducatorsmommykatabcbooksheatherNtexasjustme3mamato3nutsbingabong17TinknBugladyscorpioJorantreefrog225homeschoolsheltermom23littlefishALhsingfamilydance4him93UniqueuponitEmbracingEarlyReadinaardvarkdrew1064hischild76queencuties08CarolynVT96soccermilkdudstreasureBeccaangel00ParentLedMomto4nmorecaenc7647katcheneyeutreJungleBloggeratrueadventurerspanishspirit1hsmomof1gr8kidbeccasue1029DizzysuUAGodsgalImeyJuliantcapagrldsajemsmoni53loveablebooshygirlnathanshmrsbilbreyGirlieBlogPony123abideAdonaips13Mariella1214dnkfreedwatkinsschoolhouseTeamKleinForeverGoofyGrlPip7shallywagregan1Lizzy1Ariel0901mom2cbsjkkmnholyhartHoneycuttWeirdperson97AmeliaPipDobroturlebaneL3AHmumtoo3nicolelynettetimber399RustPrufaliciacrazy4animalsPerchickblessedmamma247jenniferarbCharley1kakali5FlowersjennelleHomebasehammschooljmtutt5Mommyto3inAZfireflowerTomyay1552potentialdreamermidwifesusiabbyReadToLivesandrajayrlynnsteeleHISGIRLS2june1292KatX3CakebabysittercarahembdDolandercathyglassNeverseenstarwars1AileengracetoukimberlyslageateammomRyan95JustMeAndMyGirlIamlegendummruwaidahkid4JesusSGAkidsmotherof2ALRebelPrincessjeneastlandarmyfamilyokkdunhammadmadammimsupernova1210BenjiGatorleaningtreeacademySALASpray4secorasewinggirlagirland4guysMyThr33SonsEbonyrose95Rachel711mandymckjenofnerhdsupplymomlearningtogetherwizzybeesFreckledFacepanoramaalways4joynicky88MaddieLynnYuehrosehavenRenmeleonSweetpetuniaiamolivia10204mykidsakamomthisoneladybugsuperjennickbiwool97Anotheryearcomesglad2bsavdmomto207reneekatemoore27cynthia908ntelasuejesusprincessConnieColvardpamrader1AmberAholeleifunnyface7211hollyburrow7jedi1motherjedipurplemommabtlfamilyLimuPrincesssuperleo100jmulva3Juggling4himHumanoidLollyPopPrincessscrufydawgPowerlineProductionsSpartanM203tazbrat26charleedenisevathacademymartinz5bulbspringer13MusicMomMunkeePop777JoySproutsistersinchristLalanenosboy14Talk2u4evaamyjeannedavishomeschoolmomjexinflSchoolinMamaonediva1968hollyholly121314o0peacelove0okmomof06Marvelousmemyfame101dbarrettstacylshomeschoolingKattJLee74madjohn85musicluvrselizondohannahVManwarielmistyc76briakapolarbearbmbledsoe1happymomjwaldrop1997tmeyer7jamk63sandsmertzsnoopyboycovfamqreatafoyaclanjraugustinecsbwhitemommy2boysanna10smithicalbryanCarilyn15sing4melyricsmaniarxecbHisalonejenshomeschoolschoolingjoybirdkeepers4manniePattilittledebbiebzmomof8gapeachDahliaSanchezTwizzlergirlreesespieces101michelle0970Angelofdarknesshorselover08hbbry917kids4medsansomCherylMcjustme71whatever2BlessingFullerPluffMuddKidsjaysaDeannaStyetyewhitleyskean4311starwarso90jigsaw674tonyapack423angelenaloobylou1971breezyblueSteph78spenceresnelsontomboy10CFScarlettwgnelson002Milonathancash1994Mercymindyglasscockdoglover08jkroweTraceySkeenrebecca9901flyingjaysPamelayarbpapershredder9smithsLYCEJ08Kelly78XxDarkAngelxXballetshoesClassical4Christcrmhsing5sanyambrownwjr1991prays4himtscarpullaSharlaAnnMustangLadymotherhnpics4youlogcabinladyBibleMemoryMomseverydayprincessWagersScienceMissy5tame5JosiahRjhuffstedtlerSpinnerfamilynubnupsimplysidneyholsonBlessed2BeMom2EightCanadianHaystackrdawnsmithkaybenaspengoldsticktoityoyodigityyobvracerTracyMcggablesHeardARumorsbaker5mandaleakyleKendraGfrappuchinopleaseHannah95kadiddlesk8inghunnyBrassie88Lordloverkochouabchomeschoolersthepixiesdenheatherpreckel3djplusthreecreacendoMrsJoryNaNoWriMoGroupMissBeereisfam5dramaqueen123motherofonemomhappyjoyJRizzle12sierraelizabethlahollisleightons4musiclover22jredmartinsFrododawnjerreneSolaFideGailBardsleykoolettedavisBonnetgirlnewcr8ioncraftscharl1egirlIzzyBtigerfan1Keetadad4himpinkqueen823greenday86chesgjjsmama21liveschoolmathopieallen81569reiscarina7thHeavenDanaCarrollbetsy624mustang67sunnisusieRNRacademyelliecsergioElizabeth79dianilaTheTractorTipperflowersandbunniesKandSsJBBLOGpinkLoveheritagechristianacademydancelovemusic13AshleyRiedelSheriwriterdiscussionswpurposeCETIzaguirreall4my2cowboysLSFspainRose98dncrabtreebirdie1977solomonpeepspearson7animalcrazyTulipMomrainfallKazmomSPAZSmurphyTrainingUpRenaRobertMKidsdocchristinarosemeanderingmesalehimamabondalbrunetteprincesslilly95butlerk4540GraceGocasierrasayscdavis762lalaloveralwaysgrowinginHimDangerMagnetUpTurnedjsks826fabulous12345cglovewaitsBlackkat923OUmamaTessaAnnabelle20211happymama2008educatorannikamomJoyfulMotherHappyGoMommySuzanne12bereangroupccparkertheforestisfullangelbear3Tangentdoodlestemplates5calebswansonmaniacMyPoultry1dfcafishycrystal824GodsGirl710blessedmom4LivingWaterSilentStarDrWhothroughtheblackstaceydezardvdbsathomeGothamCityNightsjevinFibroMomvboivinMumAramaGrapefruitJellynewzealandfrick8familycoolyboysoccerThingsToRememberHillvisionkeachlingsonebizybeethetechmanTamDoanemama2oneAmikgencafpriscillap123DMHkenshelpmeetjesshunt06krogersOutdoorAdventurerHalfMonkeyHannahsDaddyIsabellaMotherHen88LDWAvreahYuiAndStarlalisadaniellepamomjamesfamilymomputektropicaltwins13sistersquared4in4yearseightkidsjoygfcfmomofmanyzoemayanderson1cec4310aConsideringTheRavensschminkeifunkymonkeylostmymarbles4randallflynnscrossrhodesspidyboymomof5blessingsangiebe33beegirl4himxxHeyxItzxMexxuniquenessinmebiblerocker247marinebio2Bmomto10plus3cottageonthehillAllegradaydreamzgirlBusyMom123wildathearteilonwystrait2ufieldofdreamsbeckiehobbsbabigurl2Flmousearsluv2singpwsmomknechtslodgesimran101frees7kmleveretteEowynDernhelmmommysch00lin6oliviahariskaraboo26jklintcclsroses7806GirlmomSmokinAshley13literatusnpcplanierPokemon25secretclubKattskid1punkpinkky1iReview4GodAWANAGroupkimmyjlingStaciehicksterLizzyBeth107bkinggriffinslairPaladinpreacherfamilymydodgetruckPsalm103Chipperlifelybusymomof31motherbearSectorSevendebateMissJessicaecbHellokideyMadHatterOfTheStagescribblesemmajean2008Michelle122161Pupwanderingarchersteph271shanibobmomrhmfernrothladybug617WordLadyonaluluLydiaNJoymommyto5Sheri67SnoopyfaceVickiWMBFHAWreverendHeidifamilia5siyamlindalecoopannasalcoveblessedmomaphathui5granolaginanasaman8KerleyFamilyof3followerofgodJoyjeanLittleSparow2padrepio411EmmiejoybirdtTemplategirlcjholdaleanymom2brooketeacherannelilizzyykittyymomsarahcat94magsOutlawedPrincessgreeneyes111powertomoveEmily25069magsterEquestrienne21goldengirlsnickelcreek11VictorsstormchaserGrady24Cullengrl13grassfedcomposercloverbLisa2869freedomthinkerswildfireprairieroseexplorersthe4brandonsADDGirl15ihopethisworksortizclarinegohfetchonlineredcheckedAandAGRACEleadersVictors2momma24blessingsVictors3EmilyBrownnatomicbombtinkerbell2backyardboywattshomeschooltamarackartMichelleyfaith0428WestilisetteBeeBuddySLKellysmckelvieemilyjoyetkidsmomladyblessedRwemillanjpDramatizedGirl15bek93mjanssenrindyorcuttpendragon1964WhiteRavenkamirusmacrazynightmare93Agentassassinkingtmountaneyehomeschoolladyclairedoyouknowitimg1p2TheJokerKidzKornerAngie05163PirateTaletrigginshxckidpumpkinheadpacenaturalmomJT4giftseclecticityrlynn98Mickeydesireetruettkidstonekidstone2southernbelleprincesDoctorWhoFanaticSavedGirl99MissMaddyawelborncoolchrisluluspoziesbadcatsmarycabral89blessedmom4GodhollybtnEileenMKlanguagejunkiepinkis4moilavendersbluesblairbear000CowgirlCassidyessanmommyVideoBiblethewordsmithJenmibromikihasatstoeblackburnfamilythevintagehomemakermonkeygirlrulesLeaChomeschoolingmama2WhitneyAkin1mnms4himLuvMyTriopaulamharperplaidchucksAlexisstearnsgraceseekerMommica68chelseathatsmeMissirockslschaafaptmommaluke2v10AshndarrenJellyBean14JJonas12m3k3hintonmomto4spadasBRIKhouseacross22002laurasmommy32artstoreJeanCorinaBKchad2sarahLittlefamscgonzaleslorivinsmamalotsoftotsjoevarrosweetskeet97DomingaBusywimomcatlover9smancioneTinabnbcutrightSambrenaluvmytwogirlsshyshaie5PamelaGourleyjessilylnn33Bamamom63jessicainMDsoybeanmelanieb112cristiansmomileanalopez9Karson832seriouslysillysissespaivafam6Victoria08melissa33minutebyminuteCountryPasturesWendy07RosannaLynhavasuwellslarry77712BANGBANG212ladybellesuttrachbffthemorrowsJensenswilliama23agodlymaidenccccJakeysmama29deaburkardhappymealdmarybradyminkydoJonasfanteisenmengerfreedomflightWreakerASK4JesusAbigailButtlegraciecabmorgii14LashacatandkerrygVAhomeschoolmomDoggydiva24mom2jandpMamaswanjuls74matthewsonwfultonruntheraceaheapesbeccabugbellabugpaytonsplacemagnanimityhomeschoolvolleyball1996Claramommato5gemscourtneyscornerlauryngirllymapetersgymcatgurleducatingbriedemithetexasandersonsmommajhsmomof3amberlee1mlfb108erinducotedmaisanosquishyE03asfokkemaqtvixenIrishmommypassionforchristDarknPinkmommyof2shoppinggetintomyboxmppedersenpurplefanaticratcliffeauthorhorseridergirlNewMorningratcliffeblessingskvenvoldenkey59strawholderdanabaabbyrosesdontreadthismewaJustified79winsomsoulsmomto4babies2008padawan16PrincessRoseKstruncdoglover11kandaceElsiechelseacoopMeggietaliapaynejenl4YoungWriters4JesusazgreenmomJoyologistbarrybatholoPamelabrown9BrickstermjputnikMessianicHeartfuntimesericalawlessghermionyadoptionmomnickjoe9495loveluvbugginsLOVEBOOKSannaleah01Sam81199lisastutzmanMatrim54yvette2Tammylynn45CarlaHoweDizineGirlzmystyleestropicalmomabundantlyblessedmtairymomwildhouseKimberlyF75tonnicdenscienceguyingreenschooldays1bethouourvisioncaitlyn98papadomSusan4himcuddlykitteneb0605Galatians220CandiJoshuaBSuperMamapsubb29emyrosiemarkandrealHeatherLVrosieroseBurrosBunchJoyKuuleilaniwisefamily2008madirayannah21BringItOnBrittFamilymwarmuthIrisamberlybigsmilemonicabrandCelticNovelistTurtle28Victors4lizzyslifekm360ealyhome3isbettermom4boobooparkerchefconnectDawnap1anocaffeinatedchristianhotcocoaMom2mirjoeNadBethany27blessedjourneyehparriswilsur5mazeydaymsjulie34naytckayleifarmgirlsseedpearlcalled2Bamomdorowat24SuzanneKaeKaeBTerry061dolevalleyfarmpaige0305MellissaRsherry67cactusmomsuemoyerLilliputdandk1997LynninTX04TemplateMachineElvishAuthoressdecooldavidnorthporthomelinkb1Chasidy94yannimamaHOHOHsquarahgirlJESPINOZAjonasluvr11pellinor5woolsheepForgottenXxMemoriesItGoesTherecswaimSevenSmithsbeauchenesampo930murdochfamilyBunnyDude4LifeFastBlackViperzzrussjreveskineternaldeedee28sadie85eltoro789varsitychem1hotlipsbartontreehouse1little2littleKristiethrenfamilyjordangrondincomfyslipperCelticArtisticWatermelonchrismchicoineAviiheavendkshullTandLJanel64PocahontassealsfamilyworkoutangeldarkjedijosiahMistynVTIanJohnbobohomi1HomeschoolCoachamycatherinecanaryMrsHkirkroxCewlDuckie13taylorlautnerfan101P31womanintrainingkaren0317countrymama77lex2008laurenhrichhmedinakkocherTanisDclaussenpckerriwhmom244nowblessedmommyto7emathemcallengreatbooks13xOcyTaviax13spearsartstudiodgh1973JodiSdancekam1bunburymyheartsathomeSahmIamLizDaLizardblestmom3MakarioskathamaranathakeeperofhopebringirlMyEnchantedFantasymaddi2008staceyraejunebug7casandraellenmeohmyadamsgirldonspeedyLPSgirlPlainlymeREACHGroupnosassScottsHelperkidtalesluvabug1katiescorner4Girlsvjuntunensgd8marjen01sharkarosaKelleyBeenjtutorthefamiliafoxmomtoLTLThankfulteacherboyscoutpopcornSoph41mamamaekoakidrumphiusahuber60hrherikajfishpurpleprincess12SoccerChicpglemkeaidymonkeyTiffanymaliamybooklisttlcmarie1993dazynayWendeeCarolineLholodook5josh10DareDevilhomeschoolharesJaymeOKHSMOMSmisskenzworshipingwarriorCraZyMenalipoohjudancerJSmith5971meleavealegacyTheFateslanierfamilyjenncheninchinashrugginabugHosannajumpingmonkeyday502abundantlifeteachertrina2585mark2585coffeydayags08sHiGwATOSdealDinogirlAndreaJoNathanCHemyrosebethemoonCedarHillmomamyhscottyahsgirlcjeeningakickbuttmamakristi3003xersize2Zody12smak11seb369ymswifeofjdsTexasPigletsMrsTaylor4everlaurelbDeNieceBarnes4hailz9AmalieGourmetMamaflachkcalicogoatgirl46klstrunclove3esNaomiCaerwynslj4981buncharunyonssweetie51759animalgirl08zoburgmcclintockacademyMamaCareysZoo8lilackaratechick1996quiverfulleichunchennolanboykarenbarlowmarienvlynnaeBahnreemiboyzmomClickClickPhotosthinkingcenterjustalittleconfused7orangehouseAnnaKeithdillyhomeschoolpattyannieDsquishthisPonygirl97MyWholeHeartedBoysRoo101Mommablisspvideogamercrossmovementlegendaryhippielmnewman12sarahkmcgowanmsmullikinteridaxRobMikeMomkarbs1256galafawaMrsJonaschrismatt999autismjmlredstops4jesusmpyburncharmedmommybernedettehomeschool1andrewsdhillhsbloggerEmmanuelstewartacademyJanetteKingdomHawksalabamameganstampsfamilydancingkatiebugjoyfulmom26belle1277maddygayle1cabookyluke99kimbrotopssrhqnlnnathaniscoolDragonLadyseimistarjennplus5omniadminschooledbymomyoungbride622Friscobooklover101Jesusbygrace1smartmamacreatorscoopgarciahomeschoolblogMarykopfThursdayPhantompinpointpesttattooedbygracetrainwreckhomedeathmetal2Thoughts3hurlelittlemaidTomySkyStampinJulesCairnszooSisterTipsterJoy1139JakesSkicrazyskysplacesonlithomesunshineonmyguitarMapleHillHomesteadsleepover02younglovealabamaandreaagentdunagan007PickleDQfullcirclemama4dapheneraeansQuarterHorseCrazymansemammacallacjlegomom3sydnilynsydnifruitbunsjennysmilesChristiangurl123txhomeschoolinmamastimpertjwinthropjamglovemkcjuliepasiecznikJoelleSynclair08brewcrewUWHuskiesChattyboxEvernhamkristy5lisafugerehomeschoolingharehomeschoolingmomof6boo123LorraineblueyesavitiahannahBWaconiaMAGAginnicsimSherryGHollandoscarCookie5765alabamalaurenswimmergirl4JesusThePrairieKidsSlyJensenMilknHoneyTheWriterPhantomSparrowStellaJewellmdtkjrzcbruisinbritbratttxoxlegosandi2starMcKinBunchdeidracharisesibs02ncrstarCampBoycourtneyBourcountryschoolamberzSayaraJoJo85reidTwoHeadedDragonforthekiddos2008kaitycabKarinablnapoliOverDaddyBassettcrazydayBountyHunterlidtothejartrainingtonsofsonschanteencoretvbloggersmjtvedtPraisem04Vanchyrineharts99223lovinhimdreamanddaremamabreecherTheCrazyMomchgraffmsearleBluejay37NotJustAMomdestinyjoymansmomScream16libbylouwtanksleyjrAlabrelkathydmcdmilkmamma67jasmineneillightandsalt2hickshouseholdMommaElspethCMotsweitz99xchasingdreamsx3CassRoseJazzyJezzy08benwaggzzAmyMroskostamperniamatcath031972HistorymakerthatgoodpartmaddyjohansenjeneanctJodieMaeccwaldemarWZfanChrissVampiressleilarothermelginn8888henrysdragonHomeschoolCrewVictoriaElaineengravedcr8tiveCayne2010NonnieMariaandrugatorcoolryansrod21smallhoursandrea37StaleMate8Abbie2008LTaylorRosieDragonflyWoodsmommy77TAGToyslibrarygirlsrvhim4lifebamamamaJedjessrow5CountryHeartbrandnewdaySweetestpairmotherlylovingourdanielsfamilyJoeFanWinryXAutoMaildevotionsbystacyonSchoolhouseLanecod4evermamahobbitchzrj04Szionateamacademy4yeshuaNaomiRebeccaMiamigirl2daughters2lovehgmAnitafaithtristindlgordonidhittellSisPetskjasacademychildblesseddogluvamdillman99thatmomlarorneKimForChristshaylasstoriesCassysStuffRoseLisa1993boo4momBrianRagsdaledonumgracepsilvasautumnsnowblessedchaosskyshaddbensbirdsYelisscabaseballfan3luv2bgretaOhioRuthSmartyJoneskcbabazJonasMuppets28everseekingMNmooseloverKelly2412dogboytouchofclassmebegleyaimemomebrandtmegreenwooddoinghardthingsIndependent4lfehelendouglassdakotalisakayemandolingaljesses24ThrillerBooksShepherdessmichaelslifejogibbszoomyzoomAllisonrbrsnCountryGirlGSP13snydercountyhsgroupdhenrysparefamilyqooqoomommckennaShayleencrazymomof2JonasSwiftLovatoFANS6wadesSPL9ShayCBamysharpbrandiebordenelvishmaidenskeeflekrrileyHSBgatheringMom12xjoshannieEmilyLoujrdeacon1jrdeaconess1momtheteacherMueth5allsmithsDebateKid95momtimesrfosterdgtoccipoliticschickGraceover40mycutiepyeadabrookeLoniJoyfulmusic90calebstumpfDianeShaefferraebirdsasouthplaintiffDRFlemingZoe759blcoperaQUEENREElovelovehorses07mom2jchyla514luvmydog0073jemsembracingfaithartislightabellacresmarylouguinnbboyconanpromackieshayedaysJesusFreak4EVERAnnaBethmom2CMalleyxloveaddisonbaddison333TOSblogoliverzmscheck61CharlesckathrynehorsewingsZsokaninjakarenFaithAcademyhorsecrazygirl12cookeranalisarochesweetmom80Irishclovers78momteaches2Arwen95junglegirl3cat2dlautanen7dogzarecuteyleopardfireNikjrjones1990MonsterDonumGraceAcademywpecciImarebecca16schuy1999legogeekhappyeeyorekikutotalymeme1148thisandthatccriderT4GODHomemadeHomesteadcheerbabe2011Colorguardgurlsimplebugdailieswant2live4GodFerrel5ladywolfaqdeajolinabbyh333HelpUHomeschoolrothfamilycinderellagirl14jesusfreak107galyeanhomeschoolhorseheartsrulejohn15riflekid123jamie111TheTwilightSaga000VCSCollieLoverphenomemomcaristesthtmlblogmeshiabfaith4ucamdoodle12keps920oldestofsevenforHimdrb5swbdotcommomJCHuffmanJoeinEnglandpray4rivivalCalebt23November21papamomofthree11legojangofettkberranmamaoftwooliveheadsarahnelsonMileyCyrusFan12marchmamalvjoyfulathomejbantauSybilBearBearsomebody999rubilynne4DuchonGraceAcademyAndreamom2boysletslearnaishaladonCooldude2iluveragontlmcmanusmusicaldreamerbrendenaidenBlackonyx421PrincessJoyBelleLoveLucyofNarniaaranarosemusicjunky7Sacone10MusicFanaticpollardposseFitznerFamilyadbelltbmfan2006MediaAngelsohmyivegot5GaryBradwinkjoyfulrejoicegingbearamylynn12everscottblock22volleyball101timelessboysmhtgalrebelboysophie55Mom2FiveGirlsSNLHAroseyposeyNaturalMathMade4Christmht1996delPieroluvbug4910DaybydayforhimigiveallTearsForFearsscreasycoopy005evangelinehanAliRox21KelseaAnnsportsqueenislandgirlcarrot803pbj23TexasKittyJenJacksonfaithfulmawdansmyhoneyhaileygirlsimplyher95arrowforchristthecoffeeslavePraynWashSavmomAllAboutIndiansmadhattergraceistemporaryJonyfourboysthatothergirlMaggiesMommyDesertDancerforgottensawranchKrismanFamilydarubiojjrobison520AimhighschoolMackenzieksjetKaitlinH97AhiliainspiteofmefunkygirlIamahomeschoolertonyakHughcheckmatelittleredschoolhousemeofcoursejsloffCiCilovesyouChristineGkaralynnTheHappyCampercatlovercatalinaprayingmotherdmpdirtbikeRockstarchickHeartneliohumblesahmSkylersunshinenoelleJoyousinChristelswaffordChristianTruthLIGHTkeepersheatherhfeatherWindinherhairMooplooMissActressgecko9513klbntnVickiekatrinkeestephaniehallmomto2boisdjasmomhsbiolpatsyhobbycintaro14Ignitingthefirecutiegirl12homeiscoolmomHuckleberryHoundgoogegNicoleJJanettesoShoeLivingLifeforkidznhorseslyndawetzSortinItAllOutGaianhomeschoolerDragonheartTNTMagazinemuslimokieg0dspr1nc3sslivingforjesusbrazilgirlPeytonLTheBellsbridgettblakemanchaellabird3down2togomelissamb6TheBigGuyTear4FearrMandyAalicelkinsAlmostAppropriateleairdkate42564InkClubsFunPagePammySLOL911LorrainePattersonreadboys2momSoOo12pupperlovermindyr4HeroesTheMayberryLibrarianAndreazsamhallforerunnerchristianmom3juliebNettiekayMaxwellStarkBookBaggernotjoe1justtestingSarichioutdooradventurespoochsmooch55SeekingBalance13breeganmichaelagileDelinalittlecreekdoulaamberbmersiemeangeleyestinklingwindchimesrocknrollcowboyhomeschooledgirl12mom4mehomeschoolgirl95NIlhamDeniseAllenawakenrandomnesstechnobabblersreeves01soccergirldancerocksErulisseSNLSweetnesscanyonacademymacluboldTheEmpressElvishAuthorsBestiesjensmidttrinkaJesusFreak16proudnanaSimpleSchoolingLauraLeeLionsLamybitbybithopemomof3rosebudzzSherry1170cuddlebabyblessedmommaof7sillynanoBallerinabreebreecowgirl96liono1966smackattackFaithHaleKatieKatedebgraceMaddyLinmorganday14LoveLastsForeverDeNieceBarnessabrinadavySheltergirl94doug0014Sunshine4ZachremaininsaneHannahDeanChilipenneyfromheavenOrathertunungunlugunhiznameschamotXystonmaymay32197AlfWarriorOfTheLORDAbbyandFriendschangetheworldblackwolfKhalidaAngiebby22tinybebelkimmelCarlyRocksUrWorldluvsnowIhavenotseenstarwarsdaviskidsblessedinnerlightcybilverbeanacandydrevelanncherisheachdayallaboutjoyRoxAnneBrewerKassandralegocowboyshelffinderbattlefrontboy13ischygirlsshelfieldJRJNexhuntrgreentealoverejmillerpetedowg39HSNSouthAfricacjrodriguezSydbeckymattsonkuhnlittleLiving4himalwaysYahwehsDaughtertwinmomabgk007avmayogodswings2flyElindarspacechase0Trumpet108jewelstreamamyblassloohoo15homeschoolconnectionhomeschoolconnectBeth66teamhedicanKathyMarieChristCentricAnsahNo2ellenfraser3james1971guitarprincess15blondedork360SuburbsrwhateverbuilderboyevergracefulSisterSittersksanitaOutfireCeeJayW4everpurebloomingrosehales04SheolbyMoonySpeareSunshine13kitchenmama3byseatgi2dbeckysmomArtistWriterSopranoemstermyers20labradorable2006pdvcmomtiffanysappfaithangel65rainsocksMommaVinsongodlover10learnfromgodalexschooldannisblogGodsWillowupwardindianajonessammysblogStrongmansgospeldancerbyheartXerMom2farmgirlsMIRIAMbodacious79rorowolfWhiteMist10susanhafb000aksana000Iansicibomfrugalmommabarrelracer6674cmbhccsmontanajohnsonskaterupealithehomeschooler12JnJAF99proverbs31wannabeSylviaLoweryajtlbirdergirl88KathyYorkMAFAofTulsaammtrekhomeschoolingfreedomsocalmaltraitlussenheideDecoraNyappyfreasabird9FireszippyjdboyGODSgirl16dawndinhShelleysmartmommy4mom2thebestJacksMommyEagleMountainAcademyhankventuradudegleidesstephaniejamieallencountrygirl1083MarineMrsschooling4littlenutssonicsisterTammy101Bluebirdbeanpolesk8trboyrsbe921brolandlauriecrouchhorseygirlUncertainmommyburnsrunnermattiedoo3paws3PirateAndVillainJodiUtterPreparingTheWayHomeSweetbakerHSBartistsHotDog360mcnabbOldSchoolMarmMLOeasthamptonhomeschoozeilengakeeweeChickenEscapehorselandlovepuppyckeren74belakbyrdfamily5undercovergirlMelissaPstringbeanemiKatarinaPAndrewRritzema5fruityudietesting23greeneflowertammyb37chalcedony1213XeraRoseAnna08ReneeILthepollblogMomOfFab4candace1maddygirl098ldrutterMagicstar12PipNSydhayessellsFantasyFriendsThe3SisterscamcolcutgentapinedaJenniHuskerlaurasjoyathomethestoryweaverinfojunkieSydLeeLizzysShowQueenNicolejanicecampbellDonPrileymax12kristoffjoelrawhite25joycelorenzakjuillerethorsegalltmccannhorsiegallAnnaKate957skilesvolliejeanbreeziePamlovehomeschoolTimeAdventurersthegoatsruthebryantjojasetotestingblog2jake1smartinChristianDiverPuppinator80AndrewKGracieGirl10maamenkkaablessetobeamommyTheWidowsymphonia2JennigirlBloogoodstewards2422Kimmie38017Ladyseaturtlespatrick12000kidsncookingcncnawillouhbycncnawilloughbythequeenmommymusicluverbethlee72doodlebugvechicagodancercick01maltelauridslala404MadiMaeveilofvirtuesSieSquirrelydevatoloverNoahmwattsPastorScottsmoorethelaws5wolfmawrPipsKidsjuliemiguesKelseydesertdudemama2caseComatoseblondleftynicoEnzoRustyBucketHeavensHooksjaller23Dallen425swordwieldingmaidenLizziegirlWolfeBrosTeleathalevimarywolfhappydalshackriderAslansManepumpkinkingvincentsJerseyChickAwesomeLaneyFab5FatherTheBlogOfMusicngarancesoccergal11AmyMWChurchmousegymgirl1LadyoftheMountainGracefulGraphicsLilesiananderinJman219sfchick567DanielLetchfordjoprincesswarriorroseofsharon1231youjndoughNaeNutLittleBItJobellesplaceCowboyKingDanaehorsiegirlsamshakingSingingMommaSarahx13hambar5craZgamerJewelinthemakingDanDmancandacekimovevortex252fullerfamilynmzacharywayneforthemommyhfhkittymonique21282WPetersonValmommaof4creativedaydreamerluvmydogRainaFaithvictorsbasketballschedulevictorsbaseballschedulegodgiventalentsMNsnowgirlmomof2lovebugscoreycore123nbourgeenglefieldwestlifefanmomofemmetttoadaway021happygrlSemperFidelisJediinTrainingstumpyrunaway337ancientruinsstacyabrownkatost3julieatbenjiMTchelseajohnsGodsGem4LifeSillyAdamBabyBFoodHead1995SuperDadPagemammadesigneradreamdeferredjokersoreheartrbbrown789v1hebrews11testingthemes4uinkdeathlovrRyanWilliamsKeepemclosetriciagirl10masterlaurahannahmontanajrdebiibridgettemollRyoukaiAndreaMcNabbdsarabachaBamaChickmnkidscooksalotbookwork96leslieskellyvirginiagregoryRebeccaSeHoopyDothewoodfamilymidevilmollyrainbowheartlilyofavalleyMaxerBeemaidengracetmonocHeartsongAnthonyvanderZwaagmamabeensgreengardeninggirlSunshineGalmommy25hsgirl11joel701jimgunnredsbro1bigfatcheeselogjackisolterospeedyscott1iashashtomboy2tweetyroundeyeskaitlynnbmwJe9Jeaninetipo10renee4jrmuchbrightermommaAuberyMirkwoodbakdebbieHoops22GirlAdviceshadow14auntciamcfarlandfamilysavannahferrisnaturalmom1zanewaldemarlovesbmwmeandmydollchildseyesmaddog12klbuxtongreenpeppermintmarilynw53templates4godnarniafansjenetxhoneyharperschoenwxwondermomamyAlexanderjoynevasouthpawimaginativefreakCPoiriermystikmommajsawantMrsCjstx5DannyD13donnariggs1962ReadTheDayAwayTedDeKkerscholarmomsoniclukePiperelizabethbennet20CrowesNestthefalicafamilyLatteLove63lillambswelleducatedmommissjosey101MrsCrystalMissPeaPodcrad217ariekannairbrudilettosbwsoontobemrsmureikonicholaspMomandMagistraboomister1hbfroggymayfieldgaphillipstracy2025ourwildflowersmartyhuskeraml300wilsont08hoamskoolersKelsiBrittanyAElphabaThroppSnowflake92SweetLittleSisthatshotMandiemysteryfansgingersnipkimkwalkermommasonSheralynDeborahNewbyhomeschool101AndreasworldcjtredwayalcotthomeschoolswilliamsJacobUK1996RangerAlwaysRoomforMoreLadyBugBstillgodzwillatwobrosDinomangraciebirdrnoah74UnsellsDolphin624Hippiegirl98missladybugshayr92thebookhostnicolesuperstargillberkhorsebackriding4hsbrobsmomgshinn1lshinn1mykidsmomto3TheLostDoorDebra1011Motodudegilli0screamolauren21setasidetimeMILLYMomof9kittenprincessNarniaFanArtKiarahandTalynaNarniaFan898sister2sixshadeslayer08bikerboy10LadyMaiesoftballgirl4christjoyfullhopeWhoDeyCincirodriguezclan6tiggertigger12purplepeppermintOpelmrpenguinjenbailyMadisonDane28Book10GypsLuverblondy911rebeccasjourneykatieviolinDanasMathPlaceBlueJaymomx5JustKristikittyka227pnhic9exoman111isaakhortonhearstwobetzaleldreamwalkermorganvpMamaMary40Shug71createxxbeautifuldesignxxkatiempSnowBoardChick1214evadjrickwmw5300MelMoMatriarchjbrocks2TaylorSwiftLuvr1amywoltersnavywifeandmommydcgaulkedramalivesontraveltheseaCaseGottaluvBookstemplateadventuresGamecockzGirl1111kaleighrmissyhPylegangJanetlovesbabiesIsabellaLindseyskerkechianinkauthorsDadOfSuper7authoressinthemakingpixie45MamaTLCartprincessalthebackyardfarmerneedtochatrbarkenashallvanimpactbamagirl612TheTruthToldBB8CoolBreezeGracefulTemplatesPaulaJeanladueacademyjenniferochloelaurengarycobradiamondssparklefigmentscntryfokGoodallMommadegregsotbonebigmacKathleenMckenzieWaitingOnHimreenvermontshycountrygalSaraJanejuly96TeenaEnsHappyHomesteadingMomShaddaiTrusteroladejisgymnasticsdivaMascotdodobirdkuesatorjcmjconnetcmpentonbestintentionsmommy2littleblessingMommy22ssJoyfilledwelove2learnlisacardontcnelsontraceyrox74rubyKaraboo2donnablainJoannsnogrentinbaybren09carboymamacopeRJDaviealmloffMetCoGalSusanofNarniaEdgyJumbieaventuraenmicasaKarenmarie12niquiBroadwayBellapetercheimuddlingthruseethebluesky09jacobleedudejacobleedude14TheThreeGracesThomasThatsHotTemplatesjdbeekmanmavenmomfabeekmanelecehollislove987Sashabreezejeanniesolilyofthevalley29hajs09kidsahoypandasnpenguinsSandInMyPocketmissmelanieMelody74teresajoneslosh1530amyandchildrenhomestylesethdunn99dalrymplemommabirdtmrChristianSoldierElizaOsbornLadyPorterprisca2009angiesheeleyQueenMahthebryants348happycrababbykat3Ryanallstarchicas4ChristLoriGordon39satchmoNolaMickeighfutbol24795Unbreakablebatman13ikaf1398robert42HHS123soonermomalexbug1amomhpmlauraedmondsontrps68melanieboswellPambemmasaraplbmrrSqueakshotmommaof4Jer29v11ZacAspenStephenjonessChristineBvictorsbasketballkellykatygaexcoteleaclanharveydancerbugRaznKingsKidzLivinInWautomatara2126dandchellmanXxxammysblogxxXbugandfayWillerwillwRoseRedphat668resourcequeengatorgaryelliesnanaieboo123christianacademysgsikes1997MadHousehotshotjen14jackthedoglettysmarketJennaRenaeFarmGirlAtHeartnadaphonicsbetsykwMusicFeverKelseyNicolelydiascatsgodslittlecowgirlbsthreeerinnklattabby98PaulaSummvictorsbaseballalexis2000mandmvinsonourblessedfamilymelaniediane92katenkels2starjmomQueenTitaniaanimalfan7Mariettemountaincountry43TNgirlsNarniaLovermom2kohShayna1224DrewDennisontamara974sethcbabernethyChucko815BoswellC2934corrielouisemimple97Haflinger007tamagotchibloglettucemuncherrrxoxsupercar360BeautifulSomehowbazevedoTheImaginationjustmeg94peanutkristineamericangirl1993godslilcountrygirlMacarthyrShawnaReneegeezittes122JBlover1hodgepodge91jkovaKatroseCreated4CHRISTbarnielovergirlSchwarzHequillinclan5HoldingOniEmmaLivyScottnrelchelsead92gymnastforJesusDocMistyMommy2CadencefortheirfutureCmamaof5momma2cokrausefamily1greenmomma428webkinzupdatesreapacheapweddingnovelistSonjaBraylin12fryes777mama2395BranwynBssikoraJMancini5lambkinwoolmisty5172yodasmistyJazzyGirlwaiting2bmommieRhymeshbbz154Daffodil12AEG52998goosezoegirl07nrnoodlebubbles4910FishGirlhsmom23girlsnicholsfamilyPASSKEYSmaryandersenmarzymmahyatheryalsfamilySorchatwoculturemom72csimpsonlovin3girlsInklingstemplatesmathisoonerfancsever123junglemumtracymarie5parrfamsimplicitymomGandalfSevenMs2freedom4educgodsdaughterami66mmphoustonlovinmommaTOSSalesSetherHollyDolly4TidbitskhhsteensMomfulltimeto5bdavenportMaidenPrincessLarabaKeskandrewsasyouwalkbythewayMarioJtiffanyt74jemnbamJosiahDTstephescalicotyfaithfulheartzfidosmellywellgroundedSoutherngirlwildriceMarlenechip523gigigirlraejane714rexTrustGodKerriLizzkimbaustinsewbearynice1birthsisterBlondeGirlmomofdoubledoublesBrandiCarolinaLotusPocusjen5972TLyfordjoshuahanleytechnofaithpeggy11161homeschoolmomtrishfrymanrdugan6scvioletnevaehjennifergliddenfaithisaiahGracefulracingruby1WarriorforChristkbosmom3doodlebug1tehrigJRTWMrCartersummerslaveforrestdvdbjosh3truth24missypriss21ssbrasmussengalizamountainpatriotsmjetsDSboyPurpleducky21ShyannehallsanProverbsmomofthreefreyfamilyprincesabrittany005IAMLiving4himCarriebramleejesusrockz95RecievingSightMcKeelsamericangirl93melissakayrenee55555cozosmiteBrickcarolynhatcherhape2behomeJulieGibneyathomedadsceinicthehedgehogKassie07TanyaSLovegrandmaSelahSchoolof1SonMeghan2601YorkiePalacemEaGaN12LyNnSherriBchacobchadjohnsoncrazyarmycadetmaidenmaidenoftheforestmdlong27momof3greatkidsIvanhoeloverlmrpbjJustice95republican3293survivorChickadies5ModestMomjohnzachAshtinaDevenportFamilylacayokidsSuperMommychristiansoldiersRoseyGirlzullayhrlmalonebeckyboo114sananiamloved15EandLgratefulgramahorse12321LaureeNestofThreeNarniansDreamriderjdugan3boyzandahomeschoolfrenziedmarenJudahiLOVEcolaconniesnodgrassEccentricStarfishtrinitymommyDrewcordelia98ashtonsmomissierAmyRachel17thewaltonfamilyswaney3michaelbrycejubileemomlegoben96dnapadgetts2ddsamykateshandalordwestovers7blessediLacewillowbendroserunner333jennbMicahManlivingfountainsBrittanyButterflymymommaABKelly5GemcrayandlauraAmandaShaefferPinklTinklesusanpearcedlwmyersPrazingTheLordScotiaBalachdoe965bioniclekingBIGPICKLE10raindancerAlbyiaBree11NinaDorothea1rainbowchickmaymychildrenknowhimAlecHmoochiemoogalAudigirlgimpyrkeangelLanaMariedparsonmadesignerCountryGirl97myhomeschoolsptncobra2009BwahahaBlackRosemrsmillerhomeschoolmTruthseeker55YURIKAtigerlilliegirlzpinkipig103DeannaMakihomesteadblessingsentropyfighterAllisonEgjnstracyfmangooemmcbrookslovelctabletsofhumanheartsAmyWDFestiveWarriorsewknotnormalmharrellkatjrob7saverofmemoriescrewaddictradiantpurityhorsewuver123horsebackridingHellkiteDesertEaglemaineraenarniaexposedchasingmissamyanimalnerdthesymonspetloverdarcyfarmgirlsisterchicksLiberty97reachforsuccessliveMReece94CSCAuntRobinGayDavisTybuddyfamilyof7StayingPure3joeygirltestingtesting123momofhtksovercomerladygraceRosencorusticgirl3funboyslaurabelleClaireBearsallyanne03Alyssia93ArwenTheL4SocietyNika9990ARSKRAMommaNutsnickersbenhubfamLDubInsideOutBunnygirlbookworm1313BreathofSpringtatershsSummergirlonlinefreespanishMarocMamaMBjumpingdollssoprano1SarabopLisa33emmabarrierHenryJamesWelchtygr03PaigePossummanboy77789girlteentalkSpring70joyofsixBellaQuillhaileyh46kaykaybaypeanut99Mara17zibethRKingvenetianblindJCapJCAPPCJ02tammylucasrgritzercutewriterMissParasoleChildishakoldanNickfreak99bitikoferfamilyTammysRandomness16ViolingirlMisterJTLCAdrbubbles1DRAJENGIRLallabouthimcoolcatauEmoSotoLocoelishamwmharringtonredmanchuckandleahMileyRocks1greengooglegirl556Stellarkart911glittergirl11miamorePrincessCinderellaFDJoycemikenlizvareichkathyincoloradoFlaOrientationDivajackkazziBlestX7dlmarketsCerieconfederaterosealismithJanaMartin4formealexanderryanRoamingCharactersbripam111Denbecsammy37jesusluvr111bubblegummotherbyjazieoneStarWars411scarbaby55Happyfamilyofthree3LISAD3L3ONstalcupaamjonasbrothers1fancreationistrueKnowledgeBoxCentraltreeRainaamarrkelliama4246IllinoisLoriHDANIELLEtmRavenBirdHarleyWolfpainfrogkeeperofthehouseFrogboy142300emmommyneedscoffeeHeartofGraceHSSarahbarah321alcmomMicheleSchisslerDoomnessLindsayLeannecovemombcadence9soccerhdnpowerminerChristaLynnleeleewwalkingonwaterBirdiemomLrmomchristianwMlyfarmgirl9412ScooterTestultygrl328candy4wayphonicshannahejprettyshoesChristyluttmerhappeesupermomBrownGurlProductionsHisPreciousGemsjoyfullyblessedCaroleYonnivinAmyJDdaveswifemillaaalfalaqteacherDarkFlamefaithfulacresstickynoteMRippelLoveReignsHerewvmountainmamaLaurieDMassChaosMomkatiemp123veritasacademypinkieballetsmileygirl101MJLdudebubblewrapKABee13wingsofanangel2006mamapaine09WalkinginGodslightLilPunkKittenLiving4Christ18JoshMillerburtmommyburtmcb50csedberry81bloggermomAryie63ArezKdarlpsrtabethamediawizardtabethatuttlekingjulienhorselover67madibyheartbulletsgirlrglee98blondiechicknicolew15dinolearnerravenEllaSmitCherylReevescookin4eighthow2milkAgoatMillieGracegfcfmomleighanne811leahjacobsen73mommato8yodersjbjoneschinchillaForeverfriendsmom2j1j2copwifemamascrapsAragorn012torricfenwicksuuunnysideupx3bw878mspink3lindseyfamashlinsmilesvaler1000AlexandraPhotographyHorseklollarITemplatespollo21calimomto2mntnladycaleb01starwarsluverclaycreationsrogtrkrfashionprincess111bro701AwesomeAltoHaybailershanBethyboo142girlsNazMrsJoeJonas97ChasidySGjackson1109friendsrawesomemusicgirl1014heartsforhomeschoolingHappyPonybritandjordinzblogTinyDappydorrien12HomeofLovejoychickmommy2threewindriderShamu2SeaWorld109KevinpolkadotinpariskatphifeJulieSalinasjaxxannhugheshomebasedcodenamefrecklesdarthmaul1200goodsameratinsgwyndolynCamperjenWishHorsealyssa4lifeBlackTearsBrandopwingetjbrox364jbrox1998windyacres5homesteadroundupraecpoebranchacvdawn1983avonleajulessahmsirma77ethietomewattCanuckabroadCourtneyGracezakburnoutkenobi23truleymeAPhantomChildFreeBirdieSeekerMomnesta67ratherbsewingbutterflyandmogzerogravitykwcaseyrsacdoolittleHorsesrock34KitKat246weheartmusicprincessmears07farmerjoyfulsong6Corbinlizhart2kmeandmyshadowchurchgirl2007ballet2booksBONITA60cafelatteelisa7267Legolas1mommato4mamamandyDragonofDOOMbranbugmyliedkyh1297upwardcallBeautyBreakdownAnnaNjjkkimberlyguthriedenture14abc5dquivermommakenzJoMarch14kylanjovanBJBOBBIJOTheLongbournLettersinkakrisicukirtayrsylovelyspirit1tomkentrbeach6wyohelpmeetTeriTXCoolioJellitonmartivogelsfbayfogtracybakesbreadbluelady2thatsarachickmarshgarne2stephpeter4angelagreenallmyboysirishchick17jabufordthemarkersgahsingmomof2Brightiiizlincolnsmomsolomonstoolboxbrookie76annaliegh12panolaniahlou87Vic4Godprimetimehorses4lifeshnnyjmrsnickjonasabbielousmomCovenantAcademyCovenantAcademyIIscmom2fiveKarlaMarielizzie13AlexBigHugsvioletgirlSwampmomstermykidsmom923jgjijfamEmmecuddlessudsinthebucketdiversecitymusicmomx4darkprophetthenovelKarolinaBourbonettemommy12345kallie22coffeeandconversationcourtneylane2clunatichmschlngmmFriendsofMiddleEarthdancechickSoccerStar9SmilesandSunshinerachelskoshercookingmpvillhomeJcross316Helplilgran9RidersAmongTheVardenagalaxyfarfarawayangeliknessklo289akmom4LeonaKayborntoscrapbrownfamilylearnsmomandthekidstkosmanEmily94cav5bloggerinthepinesstamperhomeschoolacwakipLadyWillowdemocraticliberaltravelhmschoolmomforeveryoursxoxAnnieKatehsnationhoenickehomeschoolFreedomDreamersmmschiavicatnipfamilyLotRDiscussionsAunnahummingbirdhollowmommahomeschoolspiritmamalauramomof4motherof7dorioakesjobrofansandmodelsCortezClanEllenatorbchgirlmdog13JoyfulMaidenDiverseDadEggsAndToastsunflower10thesearethedaysPHLVisitorCntrgettingoutdoorsJONASSISTAHSSerpentineDovesnewbyhappycampershomeschoolKikiLaylaySanityInQuestionsimpleblessingsFalling4HimButterflygirl101neetjeBossBoy98AmissanaryhopefulMoniGLearnersinlifecheftigerPfRach93bmanavkosadgirl123rapcoachLiveinLiveeaztectornadoWendyDkerrilbdanceintherainNanaElainedramaprincessEnchantedGraphicsshorty1gzusfrk00FreedomArtistsCarySylviaBsweetsmommomindelawarejensgemsmortonkimkayeEdwardlverheatherannemusic775643musicgirl775643HHNMagicalGraphicsmomtojcjjjjLonghornstxSkramer5MichelleJdjonesAnimalCrossing09allM3inM3ChristonlychildmomPrincess9TechBoyWesdaisygirloftwomnmdaiseylifeinthedayhorseyloverbiblechartsasmom72mrsmdunkshubertchristianhomeschoollisad9352MathMomrandomlyromanticgowestx4clbyrdBlestmommaredneckmom7777hisgifts04mamaofmanycaptainrexKatbody10TeddyGramzNaturalistCMSPlexibaby123penguinloverAllisonBakerZsannaBanannaGirouxtrDanae62194hltarantinodanielle09Danielle08ChileDreamingFriends4Ever123caseylalatobelikejesusethelrasterNightHawkcourtneypaigeMeekatHeartmanboy777TheNewSplashgizzyMayladybjdesignHomeschoolArtiststarsvickiestair77MeechLeighdailyadventuresPippinACreamyIceCream1sabrinawCasiaqanghaverkampteslanicholeMockingbirdHillteriberiCharrendcoffaithkeepersLindyahghomeschoolmomsabrinawadhamsbeboourlifemilitarymanhitechCheyla15KITTY200JoeJonasGirlsporticuzEZineEditorThaniaJynxReneeKMavramoorRetroFiend16cassandrasmamaGingergirlHappyPlasticPeopleBlackRoseDeathdebbiemomof3jonesfamilyallthedaysofmylife4Rock4JesusFairywingsgypsywisestarrunnergirlMomtosixnscdavidbug199827StarWarsFreakprairieflowerfarmchrissewsdashkittyjasminecucutatylernkatiechargemomJoyfulschoolhardyboys10snapapicBardlisalEntertainmentCitymaccalouenglishharechosenforroyaltyhgw316dwytnjmeCarolinaGirlHRNelson2006bubblinjoyqueennut5hmsldadof5tafkaloreleiAdriBHoneybeeMomRhartfordMichelleIsACutielalalizzycmjennifermbrandnewSeniorPromMomlcmfam1992alexmarblekingctjensensKoolCameronlellywcarecare7tbmfan06LostAddictsshelbee16altokoolcameron22ShellHallwinangel35macmomBPRDteensjenny11justus5three3sweetsmamaRebsixhotpeppersyesimhomepintohorsechelesteveiluvhedgehogsTolkienFansSherryiDesignjb007tracymomoftwokidspreecemomBrennersKimberlizStaciaNemethhfcseaApicconewhazzupaacadnatwghtstupendoSandyheb116coolcricketdexter123456789luckymomof4dairygirldiarygirlbreezyluv13PurpleElectricityLadyAuthoressesGrianBoidheachmrsgbergteenwriter3musicgirl5skyxsky27jharrallalegnacbTwistedCinderellaMichellePadrelanansirroneilujInspiredToLearnJameeKarleethetexasfiveGIRLcelebs101GroupGraphicspkaiserarielle2009writer3writer395jeeperscreepers3supermama68muddslingerz71AHGRocksElvishCreationsRyan5rnkranchWes01serenitycottagezoetrope2000jmdk5cyndicwilsontrinawicksjolenecmomIndyfreaktestimony01hillarymAnduralCainGoldenrodMOmamamollypollystyleprincessRahleighwisestepsJediKnightblessingfarmtykia1120seflowersMadelineKingsleyEditmedidyouhavetoaskrabbisbGrassTigerfaithallebreitsmaDawnnarktwoby2nicholas101299nikkinooSuperchic2000themodestKittyalbatrossfloraMcfrimzyamynicole12eashortstoriesChloeChloePiddleeternity248thoselaurinosemilymj95CherokeeRoseexploringHarrypottermouseeducareJaxbeachmomagwnicjacmomDancerchick101kolokDANGERMAN12thystledownjoycornerteach13332thatgirlismemermaidgalkrylojackiewackieWunderkindGirlbaylee768selena76angelinedlcrzcherylallinforever14chefmaddybrandoncucutablestmombmabe4stallworth6Annejdmsmithdeuteronomy649Traseegladlyschoolingmbold1213jmwillisJustEnoughLightLorKirkHolyPlanspianoplayerPLsPhotographyRelientKrazy6heartofazchatterboxModestdressesokiemama3panheademilyrmprek2horsegirl1bp31wmTereaRosekymomof4crumps5hrbrad4dsterrekindmeand3wannabeorganizedsamuriwarriorchasnmomof1GodsprincesskatieTamAnnMirdlynns11PattiHandywjmamaslcarrfeehanhsabbeydoodlewHaTiCaLlLiFeJanakkaenarebeccamohrbloodcoveredprincessjhdinoloverGirlTemplateTestersalookatuskathybutrynhannahwesquestionchickchinadsqJonasFansGetAwayMissJoyceTheKuranFamilysilentsongs95epignonejnjreynoldspreacherskidcatlover2bookprincesspuppyprincesscalledoutdwkaratenarniasuperfancubbyandmelWashburnboyindividualism1994PastorMacchill7714littlebit2000HomeschoolElementaryMacaroni1kimdeelrockiewaitingforprincecharmingKatieHKezza101fannwebbalexerzgreenfroggyrlvasherjohnstonfamilyathomekakeihaylboppThornjonbenetEthanJonesZamWeselltrackstar4lyonmom02reneewillardAnneTiquityjacarandacalebsmommaMelanie3jhenriksangel12MistyDaysGraphicsrmtzkreplin1Austinmiaraemommyrottiemixey9angieasksmccord00jacreekmoreLexyandMeli12webkinzbloggersueseisekicheeriosilovethelordRnelsenSpunkyMRavensFeatherjentoepferbunchofyodersJenniemissnorakathsdevtroup1851GeeksWife03Homegroupittybitty1bablerCatloversclubJalenagrahamcoloradogrammaAshMariealligirlforgodDashschoolonlogcabinhill2ndchancesMommaKingAussieHomeschoolerkristiegottliebmanyratsQuadsisVerticalEndeavorsjesusfreak1995hsmof3theworkinghomeschoolermixed89cherienkristabz123Sassycassie15Psychoduck29pippifireboyTrixylmeythalermomkingMysitcCreations4JSamberrmemuircorailikeikeoneblessedmamainMEDairykeeperbellfamilySuzie560Madeline365ladyak47katieGodsGiftsFromAboveshelly4823sunshinetazFragathianWarriorsmom2fiveboysncAfternoonCoffeeBreakgrandmotherwillowimmehoruAustralianGirl94kscalphtwisterchaserHambug13Darkknightvillians1BennetSistersVanadessebradley9KellNellseandatheeastsideAgainstAllEvilCalebTaylor23smoochesmanystraitspianogirlallhismusic123AEMO13InklingsAtticMotherJMnova147Computeraticmrsdrvote22LariaChroniclesljmomSchoolingontheroadscottishmamahiskidsyogar6hooahwifemomthomefergiefamfab4Tammystacksheavenshandmaidraedadozenreadadozensunnycapeclassicalsamanthathing1susanpevensienimrodel1774realBella102TemplatesByKylieSimpleSeedspenndragongracefullyHismatthew8ljaTheJoyOfPoetryDizneyFan1noblecharactergirlcottoncandyluver14HomeschoolFamily09BioAgentLORT98OldFashionedGirlscarlsonfamilythesmittys8addieRosebudblessedbysevenacountrymomFromEgyptwithLovelovetobakekidspath411joody55praydeletteReadingHorizonsmomof2b1gusand3kidslydia225virtualkingdomchildbook88megg131GemsJewelscarystuffDuchessteacherrevisedKaryng8orgirllamlifesgoodjillyme3DoodleDesignscourtney08ataralivingwatersdapianokidjkeithfamilym4mizemytmagnoliakoopakingmississippimamahayleycAlethianjerebertcourteanywadeacmelloMittiesDebbieR7mellviinx3bloggingbenfaraday23KneelingAtHisFeetKelelgenDorieheatherhead97A14rpressBigCityDreamsmomof3boys3702watsonracersMymusingsMissionBoyKillinnpakbak4evrAshtonsawesomeblogoahugirl99HomeschooledHeroeschatmanAll4himAZ6Lizabethbirdievwbmooremommyofchosen2lexieg63littlebigsisterwedenJamiesMumsoccermom2threeBCooneykeyfingerAngelGirlyIslandWahinenemethfamilyMusicFreak0019BunnyLover101mamasaidkwash37sparkels612delsinsmomcupcakers1JenBlossomsserial5thedixongangjoyfullmom2blogbratmfrias82Linkdudesundropx5MonicaBourwatercolorwakeupcallFelinedBooBooPIXforviewers2traceymichelleNelsonFamilydrdoohiskidsaregiftsCrystalmohrElizabethLibertyMelissaClaresandiesryjackzap0sweetmammabyrdquiltingmamaNaturalMommamyimaginationB0BTheOGJazluv99bowserLydiaCatGodskyfarmgirlmamamuseproverbialmomcricket78ACwiseguy4god11DomingoMillie365nanny57tworoadsmomsjk9onthebrinkAlpha7omegaGirlsofFaithK8lynLogiccatdar300smscmellaspmrktanialucilleandersonWendybeatrizMarathonCptObviousmommytofourZolasfan1RobertNettamudder74swimmerTheReptileHousesojourneracademy3candyleaAPiratesTreasuresIrishMamaIrishRedfaithfamilyfibrodsetdksHisRayKellylellyLadyChloeRoyalIconsjoshua8822KingdomHeartsStorywendyhiltonbananablooRobots101wiimandonaldjosh23texasgalTemplates4U1RainbowCupcakesmommabear3emcomLuv4CharactersshankawhiTammysTalk2412DJgangjoyfullivingRevel89TheLadyClaireariaes46samkayKaelynHHomeschoolrjillian99kkentyFunkiMonki360Tater96friedchickenLilbearWHiltonTheTrioT5Clubhousetinabettencourtblogicdrewmama03babybugscrapperTheWritingGirljbnsbHopietherossfamilyjourneyshannonsrexrodearizonapridepilgrimesBekkaboohiscrossgamestaylurr09annabripurpleTeenFashonTemplatesbyJoJotripp2allysiluvpandasprairiegirl95girlsbasketballtruleanikiwisehofsteehomeschoolhomeschool365CharlaMalicia1324sharlanickySungbyrdDanceFreak101happilyretiredTheDebatersmercymoonFightersForHimfashiongirl16fryefiveladyelainefarmerbrownSuhaleysister2sisterMellanieklsteppecupofjojoagfrost05steph2010drgeoscottstipegangpageturnerPeacefulMeadowsakgirlriverstreamscheerqueen123babycanreadnowAbeautifulmess1995camper12HisWisdomGuidesMeLonelyMonsterkeibugsacredprogressPrincessPeachPetalapplepie94HSGirl093Flickboricuangelgemsmommylisacdfdavid5234kehariAkiledmoneydemariusangela5234sillywillyCORYCDFIvoryanaangelaperezcrochetmompaintbrush93kpfrog2facepaintedlegendTia9EmmaVolsenphillyforthekinggaelchersheylover12mommyof2g1bInkheartFanClubvic3460neeshatrevon212bejoyful65MiladyJessBookLoversMom2RocgriffigirlRenee09ibeautyHomeschoolOnlinemario2narniagraphicshomeschooltweenmommyforlife82ElvesOfTheLadyLetariethan10SuperMutantsTemplatesbyMegjolleycookfromscratchzekeswheeljennebekergeeksquad821dyslexicteenCityLightsprincessof8snoblossomIrisstaylormc6Akela184dearmargaretBeautywithinriversideacademyHistoryLoverbird199810emilytTeenHelpLineGraphicsGaloreJassimmonkeymama311emily2tlbuchananmeelamrehomskoolkdandbzmomtemplatezquinlynhomeschoolbakerFinalFantasy7hhhaaappppppyyymoranskicountrychristiangirlBooBoooBeccaheavenboundmamaDeborahGriffinTheAlienChroniclesfairytalemomCam0399FlowerFunLollisMommyamb97andria94ishowkellysfourboysbevinbabygirl98backwoodsdadDiscoStruckedjamiep111JustifiedbyFaithladybugddYoungWritersAnnaHaiboonngStardust95cathiepoolthefamilytogetherTheFury2157fishlolnixxiepieiheartministrySimplyMyselfsarahmerosheltertreeTemplateQueenFELLOWshipFRIENDSpepper123RebekaSPARKLE2ttyouarecoolpinkdevil09skaterleFreedomMomScruffytkdemilybrookeSakuragodloverpeculiartreasurelegobobafett900allycatplanterWWAHHMpreneurunfathomableloveZebraQueenmudshell1joyfulheartsandfacesLiveLoveLaughLivewthFHLBaldEagleAlasamariaTeachU123Bulldog32KingdomHeartsBooBooMountainPIXjdking0007jkliemproudmomof5stampinjillstoreblogcpstimpertahomemamaof3CheckerzyahyahmelheathermommieKeagenECotaTHREERANDOMLETTERSMamaKatNinjaPenguinChasBarnesTNlearning2growBubbaScottster96ghbutterflykisses2593cherilnlilliput80bashirswifeTemplateMakerpixiemommacrystalskylinetempsStopAnimalAbuseTraceepinkflamingo236ChipsnJerkymekelikikiakahapursefullofdinosamylynn41LuckyLadybugsSkateboardDivaFarmfunniesiTestjuliac321MiddleEarthlingsgenesisgirlsRAJonesdbarfootshawnsas311mariamorrellhotchkissjzsnowjlobullardLizMcNamaraJustusBrotherswelovehomeschoolgracehomeschool3school4threeADCAMLadyofGaladhirmLifeinmyshoeshewhosavesMomaPlayfulAngelEcoGirlmrstddSWILSONiCreatecuriousatticoneroomschoolhouselouislaryssasamkelley97bethkMSMoMmanboy7777myfavoritethingsunikeone909AngelartsPFCaamagistraIndyLDSgalmomof3blessingsCarynJgigitxColersTimmyBooksofaBookFreakimake10gracek1marliahRachluvallsgo93juliebremaureenskHayleymeWanderersurrystorm25PatGodsgurl93bermyangelFanderalHallynrisingClarks2YWAMpattyerinjahiMissStitchZorelletoolman10betzy8Acts2031historyguy12jenniferljonesblessed2behome7louwrensamyggDorothyAckertphomeschoolmomMissLucystollings5923namastedoulahotsaucestylekitthappywifenmamaRialilwonderHandMmommybusymomto5ColorfulSmiletawdragravesgang11pambzhomeHitchhiker101sierradreamerdinoman7yagirl96bluebird99kkbtinkwabbstersbooksmommy2fiveFromMyDeskPrisirisbygodgrace4NJDesignsshaneshelpmeetRosesunoAnnyJo97tmasseyheadzookeeperChaoticBlissShatterediamondskatpat23marilynstoltzfusmamieviwoolenmaryruthdogs4jjfilmmakerelijahtbanditgymnastxcrystalCelebCitytestingtestingSakariHelkiTheReadertheLadyBealesteph11SH101thehardenfamilykedreyerldasdcaInsightsAskGirllegomasterCanadianCMMom10RockStar97electricrosedaisy1Photos4TiffjennhosierTroopersTwomissamandaBuglLadyeaheitmanbrleonardsuzycdberawr823SixStarFarmMomgrannykatstartoutjamminlivinglargeBrieBigRedBirdMissKahoobajazCMwithaTwistjwbTheHomeschoolMommyRachelNCIntotheDogHouselivingoutloudRawr643sweet642CatherineJAAndrew2LauraComfortbookmompetlovr4evafaithful96cornerstonefor7trixiedoeashleydumas4prosperityfantasyinasmallworldenertainer4himtorchanewmomjaam1224faithhopegracehippgothIrresistablygracedGlowingRoseTripleHeartCookingGirlWayfairingStrangerstrupp0623eslittleton95lisajones1Slayersabster12zahra5797deathmetalDonnasblogmalenkianaturalphenomenonauntieneekerUndoTheHorsePenTheReadingMaidHarryPotterFanClubFansOfDisneyClubCutieGabriellakireinasunriseacademyJediKnightslilsingerchickHotwheel99cassfam7ajt316defenderoftruthlexaloo97BridgetSarubinGuardiansofGahoolePoiemaemleebryonycastrillojennsofjhehasplansformeLizzie19sammysweat9YoungmomteachingManyXsBlessed10lizardsupergirl309PaperYarnGirlZJacobsenHomeschoolerforChrisglasscandieliltink165DesertPrincessWritingForChristFabulousChloeListheforensicnutagapegoldenstamhanleyBaptistHomeSchoolingMomdaylightwritervictorianjusticemaximumrideLordoftheRings4MeGodlyGirlsClubFFKHClubmarioncountyHeatherLynnCrystalSeaJakobEAJ98abijakeSprinklesjewelryVelanciaPrincessMihannaactionspeakssunket77heatherlmixey67concretegirl412selkefamnewseasonBlessedAdamischwarz5wallacefamilyCookieMonsterskoolin5CaliforniaOnlineHSlizabeScienceFairLadykaratekid1Gravymom05lovingmylifetaffytulipmamaof4monstersSevkgrimes04luvmy4angelsLOZSMClubSDempseyktwenselFansofBatmanCatherineHansensquincleJoniBeanMamiPercyJacksonFanClubTAMEKA10lexieandjujubeeDeborah7MusicLoversPoetryPrincess2009BlossomBlilchef9thequickfamilyDeniseDeliaourfamilyschooldaisychainjilllucasecwkevinmomonamissionWingPoet97Frodo1418Chatterbugsunshinesta8macdaddy05621goodmommi22jddavidoffseagypsy26sherriehaydenstaceylazarocrystal28haxhajmamaGirlscmgrant999villianacademymykiddos00livelaughlove16thechistianhippie98liomeshiothemeece8inariargenteusNissaRaeChefsbdroberts1998coop2000sisteroftwo2009CharlotteMasonhammingdadRecumbentHeartmamalovelockmom2boys030507kfreekavekaveboyLHarris1044talkinnicksavinggrace4youFriendshipbraceletsronettCowBoy1FallenAngelMooreAngie4JCWriter4GodSharpieshomesteadlifedarthblake429lalagirlMarchWonder3LESLIEDMORGAN01TeenStoriesViolinIslandCalicoCorner1godlygirlbpaigebatsonchristinegathomeSimplyKimlisaalbinusuclanblessingsmrsbcoolkoulee8bardenJurassicParksDogFanClubAlmendarezniecefamilymamatanyaamy0776jenleaSibyllecurlybengosouthmomskuller813crystalskylineMammaJoymommasloanezacbecmomdhillspecialblessingsmakenziemjuniorGFChefMarblealittleeskimocaretayGroupGraphicsTestermaamamasonbeaconlightacademyFCABaseballsolidayj2000michellehbigmacfromgodthebarnyardchicksadiesundancerjumanjismileyman101emmanemmahermionegrangertwilightfan47ShepherdsfoldMelody10185gkranalchemy4kgirl1999ThoughLorienDocumentMeliangrace2uLittleChloeGirlDieZeeJoanBrammeierskiing2010knitgirl113schoolsmart302mamatresbarbiegirl16truffles94myriamTestblogofSWFDarraThelTanisLyraEscapeTheFateCupcakemommacrunchdandydounneyjllundgrRachelWeepsfor1puppethousehedgehogthezwomann3incheselizasblogtemplatesDarthZannahitsallmootmarno98dnummehunterschnell1coolmomdebhomeschoolElleAngelGoatladyhollys92izymoesydniemourstorydirectionsamybrittonHarnersbm4Christrlsennsisihope101beamerr09SmartAleckPokster99MsAvonleatwinmami01LizM2010foxracing109MoonPyeRAnstedjacquelinemomMomofmany926ComapssionandGracemom25kiddosGracieKuenstlerGracieKrustylova202Braillemom1kwybengakevcar0603latoniar29690LadyMarionBizzimommiofboyzRedzerodeerwhispererkjvindianlandofcraziesPiratesTreasuresTesthenbeckyDavidKCowboy27amun0140magflodustybootseggygkputtEeveeeden321tfalgoutfreckleface1MusicalBeckyrobinstanselRainbowReaderClickerflyTheBarnYardHencoolkatie00ryanfamilyhomeschoolthetalkingmimepinkdaisycareyfamilymomofgemsb1gmamaleisastokesgadejolieGoomomdiannanathansonwendyleighKristi42006mom370733boyskmom3904BrittanylouCELI2009RobertCoBumblecreek1adammureikolittlemamaIrishAuthoressoliver6RubiksDudebraxconCommunitylearningBubbaManOkieridgehsmom2004elithegamerelsbetnorischaseTornadoestmillerdani123mtngirl78ali4slsaisaac1919luvfreeOutcastLilGurlnatureartistspyemulticulturalSupergirl4sarahmosmithDelica2dianeswdeut67familygovernesskdkarenthecomputerwhomekidzflkollpaul2magvanessatoveslearningisfunwhitsinnframefunnyfarmjesusismyprozaccinmorJessycaparanormalchickenpassionatewriterVelvetandGrandmaHobbesstoolfire4carsonGuienapiggalmhudd23Nscrib905TheAuthoressssoil165gileskirkncyesmaamokiegirljke7005phoenixrayneRoseofThornscraftydiva135Widow5annknitsHannahsMomGenevieveHhsdad4jcJoyfulSpiritdarthsarah10twinsma510ZoeZoDogfairytaleprincesslittleastronautspickles1197TheAuthorsBrittanylucillejonirhkatiehowelldamazingmamaiLoveministriesslyons75OurAdventureemmasparklehmorganWordCraftermangopassionTexicanTonyapondersSarkutolovehouseluvsabcdColleenwritessvhomeschoolersthingswelikethepirateclubsamizellfamilyCalahankrdonnellweehoodlematthias2000homekeepingmomvaldar555audey98dscderSSTesting94Jeremiahacornlittle4bakergirlsAllyCullen810953plus1blessingsseaotterrkanyurthewihillsHollyGORubyBarnabasGirlsOFaithquiverfulDaLuckyonejrtaylor13ladyredquiverful2shine4himkhatsCAGonzalezsarah5798cherrypiebrennaonotali12leapbeforeyoulooktnhomeschoolingmomP31beautysmartvolleyMamaJamiahtammcortezzcpgartangal4x4texanstwinbloggersohnomypeppersNaturebughomesteadchristianmorgan918footloosedollbookworm50emetcalfTeenGirlCraftsRainbowSockslivingislearningadbrownlbarriosakjhulMickacketrynity7cheezerX3heatherlaynejulietcRenJacYHWHsChildKiokothankfullyninelelu9000cristalmissionheartcamoman100ragnarphunjoejennypanuntowilhelminamommyof4angelstaylorgrace2000savannahalexis99jillian14cwlsgirl98thewhitefoxgarboodleshanni3000StoriesThatSparklelegomax97faythfullmomto12TayshaKellierblaurinomeandwhodawnrisingPurpleSkySkySkycandy123joeby123ShannonMRKJsteppinguptothecallCatloveralwaysmariahomeschoolercrazyweirdopaigenicholscarsynpigletmsuchristinamariaStoriesThatInspiremcwhorter4catehoffineUnusuallyPlain2010lisaskiPJpollard13AerodraeBetameculiaHannsStoriesThatCharmGirlzofFaithblssdmmm1NotJustAGirlCatzdixiecup02Messycountrygurlsoniagirl74petgabpenelopyjenandnmicMittensCassidy99emnm7kelsey14dude15momofcmKatelovesJesusBJJellybeanLestepTheBookClubLandonSabdesignslavamomtreehouseacademyRobynScjdvinesilove2bmomdragonstormEmrainiswonderful1raneydaesEstherRpadawantobe13xXCassadeeXxStephs5AnimalLover567cinnabrstbirdgirlQueenMablandamarkhamMomsUnitedcinnabrst1fantasyworldnaturallyshellyBarrettFamwl0910jaclynchec2009JenSciontiSculptingkidslibertyroadopusfortisgameguyrjreadersslaveshipGossipGirlDirectormarseeyaKimberlee23jewelllasavannahlbearsweptawaymomKmanSuperSmashAdventureDavila3somethekelleyeightrhondaenglandbeckmomJamesCottinghamcheryllynnfayethefaeryLadybug91stashmax09rockinhard4JesusVCarey1632teachingfor2jonnylegacyacreslaneymac2cody17gretchenmorrisonHannah97roseannatyler12joyfulmarmee28pmshadowabbybergerthegilpinsemail4vhhanneh12Lawaunajoelle54look4hiddentreasuresherodrx1NRRISCOOLXhonanitaMontsyMissDebMissMistyJOlivasBradenj14000DaltonjELaurenHIsaakjAlainaHCaliGirlLaelnene5983jillexnerDawnBelievesdougandjhonaZoyLyndacalieghjoyslnbkChristianReviewsFizzyClayton4FTBLArcher4ChristjasontracyExuberantGentlemanrmb724soglad2bmomRikumjoinerEarthsongwarmfuzziesHomesteadAcademyrosalindrosesmeabow4HappyHeritagetgwalton29Krismanhomeschoolbrilyajoyfulhomeschoolthefathermorlikmarthakatmck14BusterthecatchathamchicHrobandkimTysblogGeeMomonewasealscajun2dejager7LukeFunJediMistressthreetxns2luvSydney1965homeschoolmom2009MyHeroismyhorseMikasmaProudMomof2LaBellalittlemisslindsayeuromomTemplatesbyGipfishmelindageCrunchyMomof3avatarsweetsseniorchicahopefloats79jcadiz74ldgermanynarnianoldersisPollyannatalktodeb1974GaMtnMommaLuvnChristCatasbrinanonohyattCharacterClubsksundsthemombrigadeAkanaheRolePlayersVintageviewsserenamorrowColleengymnastgirl12ilovetofishhgtronjewishingstar98AvonLibraryBrailleMommy22breeze1177victorsnewsannerie66spicemantabs7mystika1Dialedavemythreesons2000mattjake123iBeagleInHisEyesOnlyHomemadeDesignsChickadeescjkizermamajane8chriscintanHDchatroomwhoagilbertTatertots2VCarey2017momnthekidsCLLwolffenbutteltotaltagsJoyful1Volleyball98NicoleH95Meggie4uCarolynsYellowHousetalibiddeenjrCaricaeHeroesAndHeroinespointshoeshomeschool2kidsHome2Staylearningforfunhoopsgirlbuchanan6mom2allboysLuminousLynxraysherryAnDeepreschoolforeverMissyNicoleSherriLGodlyGirls77loblollyCathiLynMadelSarahbeans44pixel8ShellsZachPureHeartsrfc1997elkhollowjen2150NarutoFanClubhsbabybadamsnatedog10frommynestRedDiamondNewsfremontcoilpcAllisonandAllifourkittysTGlivingAcademyBeloved8Emilyapple7jz4realBabyCakesforhim99Problems4theRebelBooBooBeccatravstac6BooBooTemplates5fornowlighthouseNickParsonsHeadmistressChickenJanetonyamommyto6HisJoyfulDelightsVideoGamingChristianAuthoress95w2bm24TeeseElibeeChickPeaRepellentMoonshadowkorkyoAriaktroendleanonymousbloggerwebbfamilyJuliaSuarezMizellFamilyindependenteaselkarrie1908greenlilytyingstringsAnabaptistMamajotriplejCleverKidsAcademyjennibee23MamaVanGoghaffiliateblogConstantChatterPrairieDawnPipChirpNotzmommee42boyztriciachillydogMarnICARpoLeelliebeanbearsmomma7gratefulmommykar915godfirstacademyprovidenseMamaDoeSusanVerbeeckadopteddaughterheirsylvietnMissHannahSimplyBearTrinity2009SongWritersDogLoversStrangeTalesransomatorhomeschoospotltrickypuritypianoteacherjoyUnbridledDreamsKerriAnnKatherineAnneDawnfrugalmdmomcreationyenca615KSmarshallfamily8jhrobinson20IsaakJonesTaliaRosehope12lmb1128homeschoolcandyOrgi13StoryAriannaJoyNaNo2009mjcarleyIconoxTammysSaygopaulaKirsjiSethD15GeorgieSweetPCapebretonleia14holmesmissporterjylorawhitesarahspeaksjoellesdolljewelryladeechapmanElizabethscottyjustbeingmommydymentamystu3ti29jjuvedeedeeOrganizationXIIIshelbycoalhsIzzyJoyBeeBellHorsedreamer1farmdude6birdladyLaSarabookwormlucyrainbow37jackie1992swift081702mikerryhMathusala0anonymousrytermommato8luv2bmamibaileebratcherkaelynZexionandKadajspktmeMomOfAdventurersZKidsFaithisthesubstanceFrancieandSarahladeebugBstillspf7the9hartslorafamilyStayingStrong3itslaradanielkuchmanSyraetheMommaJ9turtlegirlNoahthekingRsbalaktjbalakruwachSarahCambellMamaBumbleCowsikestonhomeedu2gemstonehomeschoolwinstonrockstar1barnspelctjeacblackHorsinAroundKikiMariejames12kyrednikchickkinderlikegodkentbabeegirls1994chachakrislaerina11stacymtkdgirlsdadamsStef789katygoslingsEstherWardsongstarsongstar10mulanaileenmesjllsgwynmendezExplorerHomeschooling4Godaileenpizzapingpongmy6lilstinkersSkyfeatherblesseddaughterwatersmanmlefreightlinergirlharokid123DazzleMeLuke123BlowUpBlogLuke1423Wildschoolbeckyhensley15ahaKMillersecretmailboxHannahYmtcorHeavensAngelsmontuckygirlsewhotmommyShereelulumangracemultipliedtubbyloveJesusfreak333blawndiemomof4gypsiesStoriesbySarahxXBrokenXxmommytipstheuwiamaboy2000masadaHalfElvenBardemmajacobssjcjensenelwshootingstarmawbearOptimusPrime96elwshootingstar1carmengoldsteinHistoryNightblessedmombygraceSassyD4vtbunniesStarwarsfreakspopstarschool4todayMoonBeamMorganElizadburdie30samaritanaiden96avwpolotanmrshankbotJesusFreak01RangerRobinDollhouseDesignsSammyomomyof2Tuckboy291hippenfamilyBonnieSilverinightmaretornadobenUsborneforkidsmunkeesdkperschtheadamsfamilytheadamsfamily2theadamsfamily3autumnharvesthomeschooljenabbykaylabffHorizonsconverselover97gatorhomeschooling123123123cousins4everDoeSlayerAnnaPadawanDoesl4y3rsojujojenniferhokietiffanyphippenfamily123GirlGenius1013psalm1273TylerJSmithFannybrawneFarmingGirlknowhimmoreJoellepechixxhippenfamily8RoscaroAshTree97AshTree101Jdawg95rrellingmeandmygirlTrentbirdie551garrettfamily1231rellingralphsgirl1tapestrymomroboknightaudreykathleen96ChevalierTuckersBlessingskrwaynektchnkemstjladykinrangersapprenticeLisaWarehomeschool3b1gveggiemom4HimlegomichealTheReadersClubvettech98ilikesquirrelsthanksmamaEragon32kayleeEklegomaiViolinChicklolo4ever98Motoxrider510maditaylorPapaRoachGirlDeanna97Motocrossrider510montessorimommyMarciadavisaimMadiCatDrDaleesaxilyfaithfjc1955kristacompsonbethm95missykaenurseryknitsPureAnadamamabear8127mcandrewsconnormcandrewsdaviddavidmcandrewsKitkatkelseaanimeeyesafinkle221disneyupdatesmusicandwordsWonderMomJillCozzarieshyof7nathanatBJUkittycamo98bestffsTheBlessingsofDaughterhoodMishyMarieLyndseybaseballrocks12abbarnabytjeducationoldfashionedgirlhoodMariofancheria88bookHeartbookHeartsmyspottowritestoriesSuzanneMarieSuzanneMarieCDragonluverTandRstories9701carilynn7VintageLoverhistorysleuthearthmama26WizardsWaverlyour4kiddosscandinavianmaidenshomeschoolbookreviewdivineequineMotherKP40WarhawkAceMTloverKierstenOKOERTLEMTgirlannakiserGRANDnateself7Firelandernursejent245